DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and CG18609

DIOPT Version :9

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster


Alignment Length:92 Identity:23/92 - (25%)
Similarity:35/92 - (38%) Gaps:23/92 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1194 FAEGSKDHNLKYLICTSEGLMRTIWRILYQLDLQEFSYYTSIHDGEDLYKSEDNLHLCFRHV-VD 1257
            |.||   |..|.|    |.::...:.:...|||.:..::..    ...||....||: :.|| :.
  Fly    91 FPEG---HERKQL----ERVLHAAYLLNKVLDLMDTVFFVL----RKSYKQITFLHI-YHHVFMS 143

  Fly  1258 HGNWP----------VNLCVLLPRLKH 1274
            .|::.          ||...||..|.|
  Fly   144 FGSYALTRYYGTGGHVNAVGLLNSLVH 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
CG18609NP_611365.2 ELO 16..257 CDD:279492 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.