DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and CG31523

DIOPT Version :10

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_649474.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster


Alignment Length:36 Identity:10/36 - (27%)
Similarity:16/36 - (44%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly  1230 SYYTSIHDGEDLYKSEDNLHLCFRHVVDHGNWPVNL 1265
            |.:|...|.......:.|.|:...||:.||..|.::
  Fly   122 SKFTEFFDTLFFILRKKNEHVSTLHVIHHGCMPFSV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
CG31523NP_649474.1 ELO 28..264 CDD:460083 10/36 (28%)

Return to query results.
Submit another query.