powered by:
Protein Alignment tea and Elovl4
DIOPT Version :9
Sequence 1: | NP_724855.2 |
Gene: | tea / 36027 |
FlyBaseID: | FBgn0285892 |
Length: | 1878 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001178725.1 |
Gene: | Elovl4 / 315851 |
RGDID: | 1305630 |
Length: | 314 |
Species: | Rattus norvegicus |
Alignment Length: | 41 |
Identity: | 16/41 - (39%) |
Similarity: | 22/41 - (53%) |
Gaps: | 6/41 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 192 FYNRFYMYPEK----RSPTNIFNATTEIPLEK--LLESGKP 226
||.|.|..|:| ::.||..:|......|| :||:|||
Rat 265 FYTRTYNEPKKSKTGKTATNGISANGVNKSEKQLVLENGKP 305
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tea | NP_724855.2 |
None |
Elovl4 | NP_001178725.1 |
ELO |
41..278 |
CDD:395916 |
6/12 (50%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3071 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.