powered by:
Protein Alignment tea and CG30008
DIOPT Version :9
Sequence 1: | NP_724855.2 |
Gene: | tea / 36027 |
FlyBaseID: | FBgn0285892 |
Length: | 1878 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_724853.1 |
Gene: | CG30008 / 246388 |
FlyBaseID: | FBgn0050008 |
Length: | 266 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 14/70 - (20%) |
Similarity: | 28/70 - (40%) |
Gaps: | 17/70 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 ECKPSGSESPDVIVNVERCGAFIFPVSFDVFLQCINKMLLFKKIVRSIEHCLVLLSDDERRLLTL 189
:|:..|| ||:::........|:| :.||...||..:.:|...:.::..|
Fly 87 KCRDIGS-SPELVRRYYNLAYFLF----------------WLKISELIETVIFVLRKKQNQVSKL 134
Fly 190 QRFYN 194
..|::
Fly 135 HIFHH 139
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tea | NP_724855.2 |
None |
CG30008 | NP_724853.1 |
ELO |
20..257 |
CDD:279492 |
14/70 (20%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3071 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.