DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and elo-2

DIOPT Version :9

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:NP_503114.1 Gene:elo-2 / 178532 WormBaseID:WBGene00001240 Length:274 Species:Caenorhabditis elegans


Alignment Length:93 Identity:22/93 - (23%)
Similarity:28/93 - (30%) Gaps:48/93 - (51%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KSHDAVEGVAVECKPSGSESPDVIVNVERCGAFIFPVSFDVFLQCINKMLLFKKIVRSIEHCLVL 178
            ||.|:|.|.||..            ||...|..::          |:.:.||.|.          
 Worm   224 KSADSVPGCAVSW------------NVLSIGGLMY----------ISYLFLFAKF---------- 256

  Fly   179 LSDDERRLLTLQRFYNRFYMYPEKRSPT 206
                         ||.   .|.:|||||
 Worm   257 -------------FYK---AYIQKRSPT 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
elo-2NP_503114.1 ELO 29..269 CDD:279492 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.