powered by:
Protein Alignment tea and elo-2
DIOPT Version :9
Sequence 1: | NP_724855.2 |
Gene: | tea / 36027 |
FlyBaseID: | FBgn0285892 |
Length: | 1878 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_503114.1 |
Gene: | elo-2 / 178532 |
WormBaseID: | WBGene00001240 |
Length: | 274 |
Species: | Caenorhabditis elegans |
Alignment Length: | 93 |
Identity: | 22/93 - (23%) |
Similarity: | 28/93 - (30%) |
Gaps: | 48/93 - (51%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 KSHDAVEGVAVECKPSGSESPDVIVNVERCGAFIFPVSFDVFLQCINKMLLFKKIVRSIEHCLVL 178
||.|:|.|.||.. ||...|..:: |:.:.||.|.
Worm 224 KSADSVPGCAVSW------------NVLSIGGLMY----------ISYLFLFAKF---------- 256
Fly 179 LSDDERRLLTLQRFYNRFYMYPEKRSPT 206
||. .|.:|||||
Worm 257 -------------FYK---AYIQKRSPT 268
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
tea | NP_724855.2 |
None |
elo-2 | NP_503114.1 |
ELO |
29..269 |
CDD:279492 |
22/93 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3071 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.