DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tea and Elovl7

DIOPT Version :10

Sequence 1:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster
Sequence 2:XP_313358.4 Gene:Elovl7 / 1274264 VectorBaseID:AGAMI1_012226 Length:330 Species:Anopheles gambiae


Alignment Length:110 Identity:32/110 - (29%)
Similarity:46/110 - (41%) Gaps:15/110 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RTRD-NLLKVPEPG-GISQNDVANVAAAGPSQVE--QP----EVLVEGSQLTTLAETAKSHDA-- 118
            |||| .|:..|.|. |||......|...||..:|  :|    :||:..:.|..|..|...::|  
Mosquito    22 RTRDWPLMSSPFPTIGISLCYAYCVKVLGPRLMENRKPFELRKVLIVYNFLQVLFSTWLFYEACV 86

  Fly   119 ---VEGVAVECKP-SGSESPDVIVNVERCGAFIFPVSFDVFLQCI 159
               :.|.::.|:| ..|.||..:.....|..:.|. .|..|...|
Mosquito    87 SGWLAGYSLRCQPVDYSRSPMALRMASGCWWYYFS-KFTEFFDTI 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
teaNP_724855.2 None
Elovl7XP_313358.4 ELO 27..266 CDD:460083 28/105 (27%)

Return to query results.
Submit another query.