DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12744 and CG12299

DIOPT Version :9

Sequence 1:	NP_610530.1	Gene:	CG12744 / 36024	FlyBaseID:	FBgn0033459	Length:	160	Species:	Drosophila melanogaster
Sequence 2:	NP_609448.1	Gene:	CG12299 / 34483	FlyBaseID:	FBgn0032295	Length:	736	Species:	Drosophila melanogaster

Alignment Length:	116	Identity:	39/116 - (33%)
Similarity:	56/116 - (48%)	Gaps:	18/116 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 EVQLSCLLCEQTFDATEKLDEHLPTHF-PQPVSTGQTCDICGR--TMRSSLELHQHYKRYHEAHV 68
            |:...|.:|.:.|.|:.:|.:|:..|. .:|.    ||.:|.|  |...||.:|.   |.|....
  Fly   392 ELVYQCAICREAFRASSELVQHMKNHMGEKPF----TCSLCDRSFTQSGSLNIHM---RIHTGEK 449

  Fly    69 PNTEGHFQCQLCDKVFLLQDHLKVHVKIEHATDGYQPDEKSLDWQHYSPRS 119
            |     |||:||||.|.....|.||:|| ||  |.:|....:..:.||.::
  Fly   450 P-----FQCKLCDKCFTQASSLSVHMKI-HA--GEKPYPCPICGKSYSQQA 492

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12744	NP_610530.1	C2H2 Zn finger	12..32	CDD:275368	6/19 (32%)
		C2H2 Zn finger	43..64	CDD:275368	8/22 (36%)
		C2H2 Zn finger	77..96	CDD:275368	9/18 (50%)
CG12299	NP_609448.1	COG5048	<254..413	CDD:227381	6/20 (30%)
		C2H2 Zn finger	256..276	CDD:275368
		zf-H2C2_2	268..293	CDD:290200
		C2H2 Zn finger	284..304	CDD:275368
		zf-H2C2_2	296..321	CDD:290200
		zf-C2H2_2	312..>387	CDD:289522
		C2H2 Zn finger	312..332	CDD:275368
		C2H2 Zn finger	340..360	CDD:275368
		C2H2 Zn finger	369..389	CDD:275368
		C2H2 Zn finger	397..417	CDD:275368	6/19 (32%)
		zf-H2C2_2	409..434	CDD:290200	8/28 (29%)
		C2H2 Zn finger	425..445	CDD:275368	8/22 (36%)
		zf-H2C2_2	437..462	CDD:290200	14/32 (44%)
		C2H2 Zn finger	453..473	CDD:275368	11/20 (55%)
		zf-H2C2_2	465..490	CDD:290200	10/27 (37%)
		C2H2 Zn finger	481..501	CDD:275368	2/12 (17%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.910