DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12744 and Zfp770

DIOPT Version :9

Sequence 1:NP_610530.1 Gene:CG12744 / 36024 FlyBaseID:FBgn0033459 Length:160 Species:Drosophila melanogaster
Sequence 2:NP_780675.1 Gene:Zfp770 / 228491 MGIID:2445100 Length:705 Species:Mus musculus


Alignment Length:150 Identity:39/150 - (26%)
Similarity:57/150 - (38%) Gaps:32/150 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SCLLCEQTFDATEKLDEHLPTHFPQPVSTGQ---TCDICGRTMRSSLELHQHYKRYHEAHVPNTE 72
            :|.:|.:.|.:..|||.|...|      |||   .|.:|.::.|.|..|..|...:.|      |
Mouse   165 ACTICGKMFPSQSKLDRHSLIH------TGQRPFKCVLCSKSFRQSTHLKIHQLTHSE------E 217

  Fly    73 GHFQCQLCDKVFLLQDHLKVHVKIEHATDGYQPDEKSLDWQHYSPRSLDTTNDYKLDPILCPPPK 137
            ..|||..|.|.|.:|..|..|.:|.......|    :|..:..||.|             ||.|.
Mouse   218 RPFQCCFCQKGFKIQSKLLKHKQIHTRNKTLQ----NLPLKVKSPES-------------CPLPN 265

  Fly   138 RKYPPRSPFFNPNLWLGADN 157
            :....:..|.:.::....:|
Mouse   266 KLNAKQDAFESGDMGESEEN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12744NP_610530.1 C2H2 Zn finger 12..32 CDD:275368 7/19 (37%)
C2H2 Zn finger 43..64 CDD:275368 6/20 (30%)
C2H2 Zn finger 77..96 CDD:275368 7/18 (39%)
Zfp770NP_780675.1 C2H2 Zn finger 33..53 CDD:275368
zf-H2C2_2 46..70 CDD:404364
C2H2 Zn finger 61..81 CDD:275368
C2H2 Zn finger 87..107 CDD:275368
C2H2 Zn finger 166..186 CDD:275368 7/19 (37%)
zf-H2C2_2 179..203 CDD:404364 9/29 (31%)
C2H2 Zn finger 194..214 CDD:275368 6/19 (32%)
C2H2 Zn finger 222..242 CDD:275368 7/19 (37%)
C2H2 Zn finger 487..507 CDD:275368
zf-H2C2_2 500..524 CDD:404364
C2H2 Zn finger 515..535 CDD:275368
C2H2 Zn finger 642..662 CDD:275368
zf-H2C2_2 655..679 CDD:404364
C2H2 Zn finger 670..690 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5639
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.