DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lime and Zfp316

DIOPT Version :9

Sequence 1:NP_610529.1 Gene:Lime / 36023 FlyBaseID:FBgn0033458 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_059495.3 Gene:Zfp316 / 54201 MGIID:1860402 Length:1017 Species:Mus musculus


Alignment Length:473 Identity:83/473 - (17%)
Similarity:127/473 - (26%) Gaps:172/473 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TELMNHHHHHRQTEP------------KRHPAKMYPQIPSAIPSPPFSPTDPTDMPLVKEILARS 66
            :.|..|..:|...:|            :.|.| ::.:..:.  ..||...|.....:.|..|...
Mouse   354 SRLAKHQRYHAAVKPFGCDECGKGFVYRSHLA-IHQRTHTG--EKPFPCPDCGKRFVYKSHLVTH 415

  Fly    67 EHINVPEGTVLCV-------------------------PCYLCKQPFNDIESFKEHLTQHAAEIN 106
            ..|:..|....||                         ||..|.:.|:...:...|...|.|:  
Mouse   416 RRIHTGERPYRCVFCGAGFGRRSYLVTHQRTHTGERPYPCLHCGRSFSQSSALARHQAVHTAD-- 478

  Fly   107 AWNNTRAQEQTPPPTITPFVQSMNKPFVHPTDQHLFHSIDHGDMDHHHNAHYRNRMEFGCPPPMD 171
                                    :|...|         |.|..........|:|...||..|..
Mouse   479 ------------------------RPHCCP---------DCGQAFRLRADFQRHRRSGGCTEPSS 510

  Fly   172 FYSPPLEP--------EIPFQMPAVHQHPIQIPPMYMTAQHTAYEPPVQFL--GHRPLELRQ--- 223
            .....:.|        |:...:.||    ..:.|..:.|.....|.|...:  |....|.||   
Mouse   511 GDGARMAPHEVGMAPNEVEMAVAAV----ATVEPEELEAAPAETEEPEAGVADGDTEAEARQDEQ 571

  Fly   224 --------------------------------------------KLPMSPQSPLEPSGHPMASAI 244
                                                        ..||.|:|.|.|.|.|:....
Mouse   572 VVVAPAAEATVPDSKKDPEPDRRFREMGNGLAEGEGPSSHPFGFHFPMHPKSWLHPDGFPILGFP 636

  Fly   245 PSNQHTSLEMQNLCVPEGILTRVEEPPVLENPRPQAQDPIQDAGAGKS------------RSAVL 297
            ..::....:.::|..|.|       .|:.......|.||.:..|.|..            || :|
Mouse   637 EFSERLQADGRHLPGPLG-------SPLSLQGMGLACDPFRSVGPGAGVDGGLRAFPPAVRS-LL 693

  Fly   298 IEPKPPNAKSLAFNQGQFECNWCGKRLSSRQSLKYHESHFHGNKELAVNRLEKNLTKQHKCLTCK 362
            .||.|   .:||..:..:.|:.|||....|.:|..|:.:..|.             :.|:|..|.
Mouse   694 SEPAP---AALAEEESPWICSDCGKTFGRRAALAKHQRYHAGE-------------RPHRCADCG 742

  Fly   363 KRYKRRTFLLMHMKVKHG 380
            |.:...:.|..|.:...|
Mouse   743 KSFVYGSHLARHRRTHTG 760

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LimeNP_610529.1 C2H2 Zn finger 317..336 CDD:275368 7/18 (39%)
C2H2 Zn finger 358..377 CDD:275368 5/18 (28%)
Zfp316NP_059495.3 KRAB 155..215 CDD:214630
COG5048 <339..499 CDD:227381 26/182 (14%)
C2H2 Zn finger 343..363 CDD:275368 2/8 (25%)
C2H2 Zn finger 371..391 CDD:275368 2/20 (10%)
zf-H2C2_2 383..408 CDD:372612 5/27 (19%)
C2H2 Zn finger 399..419 CDD:275368 3/19 (16%)
C2H2 Zn finger 427..447 CDD:275368 2/19 (11%)
C2H2 Zn finger 455..475 CDD:275368 4/19 (21%)
C2H2 Zn finger 483..501 CDD:275368 4/26 (15%)
PRK13108 <507..584 CDD:237284 13/80 (16%)
C2H2 Zn finger 710..730 CDD:275368 7/19 (37%)
zf-C2H2 710..730 CDD:333835 7/19 (37%)
zf-H2C2_2 722..747 CDD:372612 7/37 (19%)
C2H2 Zn finger 738..758 CDD:275368 5/19 (26%)
COG5048 <763..950 CDD:227381
C2H2 Zn finger 766..786 CDD:275368
C2H2 Zn finger 794..814 CDD:275368
C2H2 Zn finger 822..842 CDD:275368
C2H2 Zn finger 850..870 CDD:275368
C2H2 Zn finger 878..898 CDD:275368
C2H2 Zn finger 906..926 CDD:275368
C2H2 Zn finger 934..954 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.