DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lime and PLAGL2

DIOPT Version :9

Sequence 1:NP_610529.1 Gene:Lime / 36023 FlyBaseID:FBgn0033458 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_002648.1 Gene:PLAGL2 / 5326 HGNCID:9047 Length:496 Species:Homo sapiens


Alignment Length:421 Identity:82/421 - (19%)
Similarity:131/421 - (31%) Gaps:172/421 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 PFQMPAVHQHPIQIPPMYM-------------TAQHTAYEPP----VQFLGHRPLELRQKLPMSP 229
            |..:|...|.|...|.::.             .|.|:|.:|.    ...:.||...||..|  ..
Human    57 PHSLPQPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHL--QT 119

  Fly   230 QSPLEPSGHPMASAIPSNQHTSLEMQ-----------NLCVPEGILTRVEEPPVLENPRPQAQDP 283
            ..|.:.:.|  .|....|.:|.|..:           :|.....:.|......:||:.:..::  
Human   120 HDPNKEALH--CSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSR-- 180

  Fly   284 IQDAGAGKSRSAVLIEPKPPNAKSLAFNQGQFECNWCGKRLSSRQSLKYHESHFHGNKELAVNRL 348
             :.||..|       |.|.|             |:.|.:|..:|:.::.|.....|.|:..    
Human   181 -RVAGGAK-------EKKHP-------------CDHCDRRFYTRKDVRRHLVVHTGRKDFL---- 220

  Fly   349 EKNLTKQHKCLTCKKRYKRRTFLLMHMKVKH---------------GI----------------- 381
                     |..|.:|:.|:..|..|:|..|               |:                 
Human   221 ---------CQYCAQRFGRKDHLTRHVKKSHSQELLKIKTEPVDMLGLLSCSSTVSVKEELSPVL 276

  Fly   382 -----------AFPGRVNAD------PEYPKS------VDS--PVSAKVPV--SPMSSPNEAPKK 419
                       ||||.:...      |..|.:      |.:  |:....|:  ||:|||.:.|.|
Human   277 CMASRDVMGTKAFPGMLPMGMYGAHIPTMPSTGVPHSLVHNTLPMGMSYPLESSPISSPAQLPPK 341

  Fly   420 -EIWSTRIFN-------------------AVAAAKYQPASER-------ADKYLVA--PRQQTEQ 455
             ::.||....                   ::::|:.||||.:       .|:.|:|  |...:|.
Human   342 YQLGSTSYLPDKLPKVEVDSFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKSPANLSEA 406

  Fly   456 LES---------GFTITSKRTYPLRSPYFNP 477
            |.:         ||       .||..|..||
Human   407 LCAANVDFSHLLGF-------LPLNLPPCNP 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LimeNP_610529.1 C2H2 Zn finger 317..336 CDD:275368 5/18 (28%)
C2H2 Zn finger 358..377 CDD:275368 6/18 (33%)
PLAGL2NP_002648.1 C2H2 Zn finger 70..92 CDD:275368 2/21 (10%)
zf-H2C2_2 85..109 CDD:404364 4/23 (17%)
C2H2 Zn finger 100..120 CDD:275368 5/21 (24%)
C2H2 Zn finger 129..149 CDD:275368 4/19 (21%)
C2H2 Zn finger 158..178 CDD:275368 3/19 (16%)
C2H2 Zn finger 193..213 CDD:275368 5/19 (26%)
C2H2 Zn finger 221..239 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.