DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lime and MEP-1

DIOPT Version :9

Sequence 1:NP_610529.1 Gene:Lime / 36023 FlyBaseID:FBgn0033458 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001137875.1 Gene:MEP-1 / 38327 FlyBaseID:FBgn0035357 Length:1152 Species:Drosophila melanogaster


Alignment Length:362 Identity:69/362 - (19%)
Similarity:113/362 - (31%) Gaps:86/362 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LARSEHINVPEGTVLCVPCYLCKQPFNDIESFK-EHLTQHAAEINAWNNTRAQEQTPPPTITPFV 126
            :|.:.|...|....:...|..|        :|: .:.|:....:.|.:|.:|:...|    .|:.
  Fly   694 MAMANHYETPHMNGVLYKCNFC--------TFEIRNATEIVYHMEAVHNIKARLIKP----LPYH 746

  Fly   127 QSMNKPFVHPTDQHLFHSIDHGDMD---HHHNAHYRNRMEFGCPPPMDFYSPPLEPEIP------ 182
            |..|..|.           |:|...   |......:.|.|....||.|:.:|...|.|.      
  Fly   747 QCPNCGFE-----------DNGKAKLARHQPVCAKKFRPELNLAPPNDWEAPAKIPRIKPRHGLV 800

  Fly   183 -----------------------FQMPAVHQHPIQIPPMYMTAQHTAYEPPVQFLGHRPLELRQK 224
                                   .|..|..|....:....:.||:.|             ::||:
  Fly   801 GTATAYQAMAAQAAAQKAALANIQQQQAAAQARNNLQAAALAAQNAA-------------KMRQR 852

  Fly   225 LPMSPQSPLEPSGHPMASAIPSNQHTSLEMQNLCVPEGILTRVE------EPPVLENPRPQAQDP 283
            .|..|:..:..:..|:......|...||. .:..:..|.|.:..      :|.:...|.|:....
  Fly   853 APQPPKQNIVRNPAPVRGGNAMNAGLSLP-NSYQLAAGQLVQASKKPMAGQPSISITPLPRQSSV 916

  Fly   284 IQDAGAGKSRSAVLIEPKPPNAKSLAFNQGQFE-CNWCGKRLSSRQSLKYHESHFHGNK---ELA 344
            ...|||..|::........|.......|:.||. |..|...:...:.|:.|....|..|   ::.
  Fly   917 GAGAGASSSKAPQAAAGMKPGQSPSGNNKAQFVICEICDGYIKDLEQLRNHMQWMHKVKIHPKMI 981

  Fly   345 VNRLEKNLTKQHKCLTCKKRYKRRTFLLMHMKVKHGI 381
            .||...|      |..|:.|:.....|..|:...||:
  Fly   982 YNRPPLN------CQKCQFRFFTDQGLERHLLGSHGL 1012

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LimeNP_610529.1 C2H2 Zn finger 317..336 CDD:275368 4/18 (22%)
C2H2 Zn finger 358..377 CDD:275368 5/18 (28%)
MEP-1NP_001137875.1 BSP_II <121..>226 CDD:283165
C2H2 Zn finger 951..977 CDD:275371 6/25 (24%)
C2H2 Zn finger 989..1010 CDD:275371 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.