DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lime and CG1233

DIOPT Version :9

Sequence 1:NP_610529.1 Gene:Lime / 36023 FlyBaseID:FBgn0033458 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_612034.1 Gene:CG1233 / 38063 FlyBaseID:FBgn0035137 Length:1129 Species:Drosophila melanogaster


Alignment Length:617 Identity:104/617 - (16%)
Similarity:157/617 - (25%) Gaps:298/617 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QTEPKRHPAKMY---------PQI-PSAIPSPPFSPTDPTDMPLVKE------ILARSEHINVPE 73
            :.|..|.| |:|         |.: |||:|...|:.|    ||...|      ::..::......
  Fly   372 EPEKPRQP-KIYIRNVDILKEPMVLPSALPGLGFNST----MPSAAEPGQSGLVVGGADGDVFQS 431

  Fly    74 GTVLCVPCYL-------------CKQPFNDIESFKEHLTQHAAEINAWNNTR------------- 112
            .|:|...|.|             |.:.|    .|...|..:.|......|||             
  Fly   432 ETLLTPTCQLPGFEPSLAPLAQMCSEAF----PFDSVLNGNGAPAAHVENTRFSALDLDFGVDFV 492

  Fly   113 AQEQTPPPTIT-PFVQSMNKP-----FVHP-----TDQHLF-HSIDHGDMDHHHNAHYR------ 159
            ::|.||||.:. |......:|     ::.|     |.|.:| .::|..........|.|      
  Fly   493 SEEATPPPPLNDPLTMMEPQPVQLEHYMPPTAPITTKQKIFIKNVDILKAPQRGTLHLRTVDELN 557

  Fly   160 --NRMEFGCPPPMDFYSPPLEPEIPFQMPAVHQHPIQIPPMYMTAQ------------------- 203
              ||.|.     .....|.||   |..|..:...|:|..||.:|:|                   
  Fly   558 LMNRTEV-----EHLIVPNLE---PMAMTMMELPPVQQQPMEVTSQLKGPTETLGEFQPSISESW 614

  Fly   204 ---------------------------------HTAYEPPVQFLGHRPLELRQK----------- 224
                                             ..|..||:..|.|..::|..|           
  Fly   615 PSEDGYDLPEDLECWPWMEDAVPEAGLVLPTPSEVANAPPLDGLSHNAVDLLVKDFSHLYAAPPE 679

  Fly   225 ----------------------------------------LPMSPQSPL---------------- 233
                                                    ||:.|..||                
  Fly   680 DTQNAEEGTAAGGRGTVPPLVPVTSSEGTASVAQSAALGSLPVPPLVPLAAEMNAAIEKPARIYV 744

  Fly   234 ----------------------EPSGHPMASAIPSNQHTSLEMQNL-----CVPEGILTRVEEPP 271
                                  .|.|...:....|.:..||....:     |:.||.:.|.:.|.
  Fly   745 ANNLLPAAVDPPLLGGGTSVRGRPYGAKHSGGAASKRKLSLGPNQVPEGGKCLVEGCMFRFKSPV 809

  Fly   272 VLENPRPQAQDPIQDAGAGKSRSAVLIEPKP---PNAKSLAFN---------------------- 311
            .||.             .|:..:..|...:|   |..||..|:                      
  Fly   810 TLEY-------------HGRCHNGSLSSNQPVVCPECKSSNFSNWNCLHTHLWRTHQIDMELYSC 861

  Fly   312 -----------------------QGQFECNWCGKRLSSRQSLKYHESHFH----------GNKEL 343
                                   :..::|..|||...:.:.||.|. ..|          .|:::
  Fly   862 QLCSFKTPIYSRLVNTHAKIHSEERNYKCEQCGKGFKNTKQLKNHR-RLHRTQGLGMGKQSNEQI 925

  Fly   344 AVNRLEKNLTKQHKCLTCKKRYKRRTFLLMHM 375
            :|.. |.|....|:|..|...:|::..|..|:
  Fly   926 SVGP-EGNPVVMHRCEDCGAAFKQKKTLREHL 956

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LimeNP_610529.1 C2H2 Zn finger 317..336 CDD:275368 7/18 (39%)
C2H2 Zn finger 358..377 CDD:275368 5/18 (28%)
CG1233NP_612034.1 C2H2 Zn finger 830..852 CDD:275368 4/21 (19%)
C2H2 Zn finger 861..882 CDD:275368 0/20 (0%)
zf-H2C2_2 875..899 CDD:290200 4/23 (17%)
zf-C2H2 888..910 CDD:278523 7/22 (32%)
C2H2 Zn finger 890..910 CDD:275368 7/20 (35%)
zf-C2H2_2 893..999 CDD:289522 17/66 (26%)
C2H2 Zn finger 939..956 CDD:275368 4/16 (25%)
RPB9 966..1061 CDD:224510
C2H2 Zn finger 966..986 CDD:275368
C2H2 Zn finger 994..1014 CDD:275368
C2H2 Zn finger 1022..1042 CDD:275368
C2H2 Zn finger 1055..1075 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.