DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lime and Zfp438

DIOPT Version :9

Sequence 1:NP_610529.1 Gene:Lime / 36023 FlyBaseID:FBgn0033458 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_001347376.1 Gene:Zfp438 / 240186 MGIID:2444919 Length:798 Species:Mus musculus


Alignment Length:428 Identity:83/428 - (19%)
Similarity:132/428 - (30%) Gaps:120/428 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SPTDPTDMPLVKEILARSEHINVPEGTVLCV---------PCYLCKQPFNDIESFKEHLTQHAAE 104
            ||.:..|.   |..:|..::.|:....||.:         ...|.:.|    .|..:.:..:|..
Mouse   404 SPQEARDQ---KPRVASRKYRNIMPKPVLVLSALAPLASHTAVLSQAP----SSLGQDVLNNALP 461

  Fly   105 INAWNNTRAQEQTPPPT--ITPFVQSMNKPF-VHPTDQHLF----HSIDHGDMDHHHNAHYRNRM 162
            .....:.::...||.|:  :......:.||: :.|...:.|    |.:|      |.|.| .||.
Mouse   462 SKCLGSKQSDSSTPKPSSVLRNGFSGIKKPWHMCPVCNYHFQFKHHLLD------HMNTH-TNRR 519

  Fly   163 EFGCPPPMDFYSPPLEPEIPFQMPAVHQHPIQIPPMYMTAQ---HTAYEPPVQFLGHRPLELRQK 224
            .:.|......|..|.......::.....||.::......|:   |...     :.||.....|..
Mouse   520 PYSCGICRKTYVRPGSLSAHMKLHHGDNHPKKLVCCEFCAKVFGHVRV-----YFGHLKEVHRVV 579

  Fly   225 LPMSPQ-SPLEPSGHPMASAIPSNQHTSLEMQNLCVPEGILTRVEEPPVLENPRPQAQDPIQDAG 288
            :...|. |.|:|..      .|.|::....||.   |:..|.|                      
Mouse   580 ISTEPSPSELQPGD------TPKNKNRDPGMQG---PDNSLER---------------------- 613

  Fly   289 AGKSRSAVLIEPKPPNAKSLAFNQG-----QFECNWCGKRLSSRQSLKYHESHFHGNKELAVNRL 348
                      |.|....:....||.     |..|..|.....|...:|:|..|.|| :|:.....
Mouse   614 ----------ETKSSLEEDFLLNQADEVKLQIRCGRCQITAQSFAEIKFHLLHVHG-EEIQGRLQ 667

  Fly   349 EKNLTKQHKCLTCKKRY-KRRTFLLMHMKVKHGIAFPGRVNADPEYPKSVDSPVSAKVPVSPMSS 412
            |..|.........:|:| :||..:..:..::...||| ||...|                :|..:
Mouse   668 EMILPGSRSDAPHQKQYTERRKQMKPYASLEDSPAFP-RVKRLP----------------APHQN 715

  Fly   413 PNEA----------------PKKEIWSTRIFNAVAAAK 434
            ..||                |.|.:||...||.:..|:
Mouse   716 REEALVGSEGGQWGMAGSQHPAKLLWSHTGFNCLLCAQ 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LimeNP_610529.1 C2H2 Zn finger 317..336 CDD:275368 5/18 (28%)
C2H2 Zn finger 358..377 CDD:275368 4/19 (21%)
Zfp438NP_001347376.1 C2H2 Zn finger 495..515 CDD:275368 6/25 (24%)
zf-H2C2_2 507..532 CDD:372612 9/31 (29%)
zf-C2H2 521..543 CDD:333835 3/21 (14%)
C2H2 Zn finger 523..543 CDD:275368 3/19 (16%)
C2H2 Zn finger 554..573 CDD:275368 4/23 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.