DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lime and F56D1.1

DIOPT Version :9

Sequence 1:NP_610529.1 Gene:Lime / 36023 FlyBaseID:FBgn0033458 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_495042.3 Gene:F56D1.1 / 186375 WormBaseID:WBGene00018959 Length:454 Species:Caenorhabditis elegans


Alignment Length:393 Identity:75/393 - (19%)
Similarity:115/393 - (29%) Gaps:137/393 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PCYLCKQPFNDIESFKEHLTQHAAEINAWNNTRAQEQTPPPTITPFVQSMNKPFVHPTDQHLFHS 144
            ||..|::.|......:||:..|.:     |..:..|.:   |||.|.                  
 Worm    66 PCPFCEKKFRYPNKLREHIKIHDS-----NRYQCLECS---TITKFG------------------ 104

  Fly   145 IDHGDMDHHHNAHYRNRMEFGCPPPMDFYSPPLEPEIPFQMPAVHQHP-------IQIPPMYMTA 202
             .:|::..||..|: ::....||........|......|:...|...|       |::....:.|
 Worm   105 -TYGELRAHHKLHH-SKASHKCPQCSYTNEKPAFIRRHFEQNHVDGIPCTITGCCIKVAKNRLKA 167

  Fly   203 QHTAYEPPVQFLGHRPLELRQ--------KLPMSPQSPLEPSGHPMASAIPSNQHTSLE--MQN- 256
            ....|...:      ||...|        |.|:....|      .::...|..|...||  :|. 
 Worm   168 HIKEYHTSI------PLSTEQTRSKLSFNKCPLCEYKP------DVSDDDPEQQQKDLEDHVQRI 220

  Fly   257 -------LC----------------------VPEGILTRVEEPPVLENPRPQAQDPIQDAGAGKS 292
                   ||                      :.:.|.:..:..|.|:|      |...||....:
 Worm   221 HEEREPALCTLGCGVYLGSGSVSEHLSTCSSLIQNIPSSSQSTPALQN------DEWNDANTETT 279

  Fly   293 RSAVL----------------------------IE---PKPPN---AKSLAFNQGQFECNWCGKR 323
            .|.:.                            ||   .:|||   ..|.:...|.|.|..|.|.
 Worm   280 LSTITGTSSQFERDSVSEVTNDLSENINDIDEEIEFGTTEPPNKIRKHSRSRVHGDFSCEICLKT 344

  Fly   324 LSSRQSLKYHESHFHG-NKELAVNRLEKNLTKQHKC---------LTCKKRYKRRTFLLMHMKVK 378
            .:.|.:|:.|...:|. |.:..|........:|:||         .||.|.::....|..|..|.
 Worm   345 FTLRDNLRKHVRVYHSENSQKVVKSTGPKHQEQYKCDRKSKDGDETTCGKTFRTEQALHDHFNVH 409

  Fly   379 HGI 381
            .||
 Worm   410 DGI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LimeNP_610529.1 C2H2 Zn finger 317..336 CDD:275368 6/18 (33%)
C2H2 Zn finger 358..377 CDD:275368 6/27 (22%)
F56D1.1NP_495042.3 C2H2 Zn finger 67..87 CDD:275368 5/19 (26%)
C2H2 Zn finger 94..116 CDD:275368 8/43 (19%)
C2H2 Zn finger 338..359 CDD:275368 6/20 (30%)
C2H2 Zn finger 380..409 CDD:275368 6/28 (21%)
C2H2 Zn finger 417..434 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.