DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lime and ztf-29

DIOPT Version :9

Sequence 1:NP_610529.1 Gene:Lime / 36023 FlyBaseID:FBgn0033458 Length:487 Species:Drosophila melanogaster
Sequence 2:NP_499490.1 Gene:ztf-29 / 176585 WormBaseID:WBGene00013438 Length:343 Species:Caenorhabditis elegans


Alignment Length:217 Identity:45/217 - (20%)
Similarity:74/217 - (34%) Gaps:73/217 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 EPKPPNAKSLAFNQGQFECNWCGKRLSSRQSLKYHESHFHGNKELAVNRLEKNLTKQHKCLTCKK 363
            |.|.|:.|      |:|.|..|||......||..|..:|||:.:              :||.|..
 Worm     8 ELKRPDLK------GEFLCGHCGKTFCHAASLNRHRLNFHGDDQ--------------QCLVCDT 52

  Fly   364 RYKRRTFLLMHMKVKHGI-----------AFPGR--VNADPEYPKSVDSPVSAKVPVSPMSSPNE 415
            :......:..||:.:|.|           .||.:  :::.........:|.:||:.......|..
 Worm    53 KIPHNDTIRRHMQKEHNIQRVFTCGCCNWTFPDKKELHSHNNSMLKTGTPGTAKIIAVSSRRPGS 117

  Fly   416 APKKEI----WSTRIFNAVAAAKYQPASERAD----------------KYLVAPRQQTEQLESGF 460
            ..:.|:    .|.||       |.:|:|:...                ..|::.:||.:|.    
 Worm   118 LSQHELRGEERSPRI-------KKRPSSKAMKTSDTPLTGHDQILALLSNLMSAQQQQQQA---- 171

  Fly   461 TITSKRTYPLRSPYFNPDLWLD 482
                    |:.:|.. |..|:|
 Worm   172 --------PVATPTI-PASWID 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LimeNP_610529.1 C2H2 Zn finger 317..336 CDD:275368 7/18 (39%)
C2H2 Zn finger 358..377 CDD:275368 5/18 (28%)
ztf-29NP_499490.1 COG5236 <15..>92 CDD:227561 22/96 (23%)
C2H2 Zn finger 20..40 CDD:275368 7/19 (37%)
C2H2 Zn finger 47..68 CDD:275368 5/20 (25%)
C2H2 Zn finger 76..92 CDD:275368 2/15 (13%)
U2AF_lg 112..>191 CDD:273727 17/93 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24408
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.