DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntmt and ASMTL

DIOPT Version :10

Sequence 1:NP_610528.1 Gene:Ntmt / 36022 FlyBaseID:FBgn0033457 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_004183.2 Gene:ASMTL / 8623 HGNCID:751 Length:621 Species:Homo sapiens


Alignment Length:173 Identity:38/173 - (21%)
Similarity:52/173 - (30%) Gaps:51/173 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ALDCGAGIGRVTRNLL--IPR-----FSCVDLVE-----QDPA-------FADKAREYCTSEDGS 155
            |.|.|...|.:.|.|.  .||     |...|::|     |.|.       ||             
Human   455 ACDVGGCTGALARELAREYPRMQVTVFDLPDIIELAAHFQPPGPQAVQIHFA------------- 506

  Fly   156 RGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRIKQGLAPGAFLCLKENVSSSK 220
               .|..:.      .|....:|.....:|....|..:.....|:.:...|||.|.|.|.:...:
Human   507 ---AGDFFR------DPLPSAELYVLCRILHDWPDDKVHKLLSRVAESCKPGAGLLLVETLLDEE 562

  Fly   221 KTVEDR----------NDSSVTRPLDSYEHFLKEAGFRIVRKV 253
            |.|..|          ......|.|..|:..|:..||..|:.|
Human   563 KRVAQRALMQSLNMLVQTEGKERSLGEYQCLLELHGFHQVQVV 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtmtNP_610528.1 Methyltransf_PK 59..271 CDD:461771 38/173 (22%)
ASMTLNP_004183.2 MAF-like 11..223
Maf 15..208 CDD:238310
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 235..279
ASMT-like 277..621 38/173 (22%)
dimerization2 288..371 CDD:465287
AdoMet_MTases 388..599 CDD:473071 34/165 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.