DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntmt and AT1G77530

DIOPT Version :10

Sequence 1:NP_610528.1 Gene:Ntmt / 36022 FlyBaseID:FBgn0033457 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_177877.1 Gene:AT1G77530 / 844089 AraportID:AT1G77530 Length:381 Species:Arabidopsis thaliana


Alignment Length:193 Identity:35/193 - (18%)
Similarity:67/193 - (34%) Gaps:43/193 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 YISAIDIQGSNVFLREIRVPGNRL----------------ALDCGAGIGRVTRNLLIPRFSCVDL 134
            |||: |.|.|.:|.|.:......:                .:|.|.|||.:. .|:..::..:..
plant   182 YISS-DDQFSKLFHRAMSESSTMVMKKVLEEYRGFEDVNTLVDVGGGIGTIL-GLITSKYPHIKG 244

  Fly   135 VEQDPAFADKAREYCTSEDGSRGKVGQIYNVGLQKFTPTQQYDLVWTQWVLGHLTDRDLVSFFRR 199
            |..|.|      :..|......|    :.:|....|....:.|.::.:|:|....|.|.:...:.
plant   245 VNFDLA------QVLTQAPFYPG----VKHVSGDMFIEVPKGDAIFMKWILHDWGDEDCIKILKN 299

  Fly   200 IKQGLAPGAFLCLKENVSSSKKTVEDRNDSSV---------------TRPLDSYEHFLKEAGF 247
            ..:.|.....:.:.|.::..:....|.:.::|               .|.|..:|:....:||
plant   300 CWKSLPEKGKVIIVEMITPMEPKPNDFSCNTVLGMDLLMLTQCSGGKERSLSQFENLAFASGF 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtmtNP_610528.1 Methyltransf_PK 59..271 CDD:461771 35/193 (18%)
AT1G77530NP_177877.1 dimerization 44..97 CDD:400439
AdoMet_MTases 157..362 CDD:473071 33/191 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.