DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntmt and AT1G62900

DIOPT Version :10

Sequence 1:NP_610528.1 Gene:Ntmt / 36022 FlyBaseID:FBgn0033457 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_176478.1 Gene:AT1G62900 / 842591 AraportID:AT1G62900 Length:205 Species:Arabidopsis thaliana


Alignment Length:164 Identity:27/164 - (16%)
Similarity:52/164 - (31%) Gaps:50/164 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LDCGAGIGRVTRNLLIP-------RFSCVDLVEQDPAFADKAREYCTSEDGSRGKVGQIYNVGLQ 168
            :|.|.|||.:...:...       .|....::...|                       :|.|::
plant    46 VDVGGGIGTIIGQVTSKYPHIKGINFDLASVLAHAP-----------------------FNKGVE 87

  Fly   169 -----KFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRIKQGLAPGAFLCLKENVSSSKKTVEDRND 228
                 .|....:.|.::.:|:|...||.|.|...:...:.|.....:.:.|.|:..:..:.|.:.
plant    88 HVSGDMFKEIPKGDAIFMKWILHDWTDEDCVKILKNYWKSLPEKGKVIIVEVVTPEEPKINDISS 152

  Fly   229 SSV---------------TRPLDSYEHFLKEAGF 247
            :.|               .|.|..:|....::||
plant   153 NIVFGMDMLMLAVSSGGKERSLSQFETLASDSGF 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtmtNP_610528.1 Methyltransf_PK 59..271 CDD:461771 27/164 (16%)
AT1G62900NP_176478.1 AdoMet_MTases 1..186 CDD:473071 25/162 (15%)

Return to query results.
Submit another query.