DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntmt and AT1G51990

DIOPT Version :10

Sequence 1:NP_610528.1 Gene:Ntmt / 36022 FlyBaseID:FBgn0033457 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_175611.1 Gene:AT1G51990 / 841628 AraportID:AT1G51990 Length:363 Species:Arabidopsis thaliana


Alignment Length:178 Identity:29/178 - (16%)
Similarity:59/178 - (33%) Gaps:49/178 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LDCGAGIGRVTRNLLIP-------RFSCVDLVEQDPAFADKAREYCTSEDGSRGKVGQIYNVGLQ 168
            :|.|..:|.....:|..       .|....:|::.|                  ::..:.::|..
plant   203 VDVGGSLGSNLAQILSKYPHIKGINFDLPHIVKEAP------------------QIHGVEHIGGD 249

  Fly   169 KFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRIKQGL-APGAFLCLK--------------ENVSS 218
            .|....:.:::..:|:|....|...|...:..|:.| ..|..:.::              :|..|
plant   250 MFDEIPRGEVILMKWILHDWNDEKCVEILKNCKKALPETGRIIVIEMIVPREVSETDLATKNSLS 314

  Fly   219 SKKTVEDRNDSSVTRPLDSYEHFLKEAGFRIVRKVKQQNFPKGLFPVY 266
            :..|:.........|....:|...|||||::         ||.::..|
plant   315 ADLTMMSLTSGGKERTKKEFEDLAKEAGFKL---------PKIIYGAY 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtmtNP_610528.1 Methyltransf_PK 59..271 CDD:461771 29/178 (16%)
AT1G51990NP_175611.1 AdoMet_MTases 137..343 CDD:473071 24/157 (15%)
dimerization 30..82 CDD:400439
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.