DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntmt and OMT1

DIOPT Version :10

Sequence 1:NP_610528.1 Gene:Ntmt / 36022 FlyBaseID:FBgn0033457 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_200227.1 Gene:OMT1 / 835504 AraportID:AT5G54160 Length:363 Species:Arabidopsis thaliana


Alignment Length:164 Identity:34/164 - (20%)
Similarity:56/164 - (34%) Gaps:39/164 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LDCGAGIGRVTR-------NLLIPRFSCVDLVEQDPAFADKAREYCTSEDGSRGKVGQIYNVGLQ 168
            :|.|.|||...:       ||....|....::|..|           |..|       |.:||..
plant   203 VDVGGGIGATLKMIVSKYPNLKGINFDLPHVIEDAP-----------SHPG-------IEHVGGD 249

  Fly   169 KFTPTQQYDLVWTQWVLGHLTDRDLVSFFRRIKQGLAPGAFLCLKENV--------SSSKKTVE- 224
            .|....:.|.::.:|:....:|...|.|.:...:.|.....:.|.|.:        .|:|:.|. 
plant   250 MFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECILPETPDSSLSTKQVVHV 314

  Fly   225 -----DRNDSSVTRPLDSYEHFLKEAGFRIVRKV 253
                 ..|.....|....:|...|.:||:.::.|
plant   315 DCIMLAHNPGGKERTEKEFEALAKASGFKGIKVV 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtmtNP_610528.1 Methyltransf_PK 59..271 CDD:461771 34/164 (21%)
OMT1NP_200227.1 dimerization 34..83 CDD:400439
Methyltransf_2 138..342 CDD:395719 31/156 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.