DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntmt and AT5G53810

DIOPT Version :10

Sequence 1:NP_610528.1 Gene:Ntmt / 36022 FlyBaseID:FBgn0033457 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_200192.1 Gene:AT5G53810 / 835462 AraportID:AT5G53810 Length:378 Species:Arabidopsis thaliana


Alignment Length:176 Identity:34/176 - (19%)
Similarity:62/176 - (35%) Gaps:37/176 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 LDCGAGIGRVTRNLLIPRFSCVDLVEQD--PAFADKAREYCTSEDGSRGKVGQIYNVGLQKFTPT 173
            :|.|.|:|. |..|:..::..:..:..|  |..|: |..|           ..:.:|....|...
plant   219 VDVGGGLGN-TLGLITSKYPHLIGINFDLAPVLAN-AHSY-----------PGVNHVAGDMFIKI 270

  Fly   174 QQYDLVWTQWVLGHLTDRDLVSFFRRIKQGLAPGAFLCLKENVS---------------SSKKTV 223
            .:.|.::.:|:|...||...|:..:...:.|.....|.:.|.|:               ....|:
plant   271 PKGDAIFMKWILHDWTDEQCVAILKNCWKSLEENGKLIIVEMVTPVEAKSGDICSNIVFGMDMTM 335

  Fly   224 EDRNDSSVTRPLDSYEHFLKEAGF---RIVRKVKQQNFPKGLFPVY 266
            ..:......|.|..:|:....:||   .||..|    :|..:..:|
plant   336 LTQCSGGKERDLYEFENLAYASGFSRCAIVCAV----YPFSVIEIY 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtmtNP_610528.1 Methyltransf_PK 59..271 CDD:461771 34/176 (19%)
AT5G53810NP_200192.1 dimerization 40..94 CDD:400439
AdoMet_MTases 154..360 CDD:473071 28/153 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.