DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PCB and MCCC1

DIOPT Version :9

Sequence 1:NP_001163103.1 Gene:PCB / 36020 FlyBaseID:FBgn0027580 Length:1197 Species:Drosophila melanogaster
Sequence 2:NP_064551.3 Gene:MCCC1 / 56922 HGNCID:6936 Length:725 Species:Homo sapiens


Alignment Length:462 Identity:203/462 - (43%)
Similarity:291/462 - (62%) Gaps:32/462 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IRSVLVANRGEIAIRVFRACTELGIKSVAVYSEQDKMHMHRQKADESYIVGKGLPPVEAYLNIPE 103
            |..||:|||||||.||.|...:||:::||||||.|:..||...|||:|.:|.. |..::||::.:
Human    49 ITKVLIANRGEIACRVMRTAKKLGVQTVAVYSEADRNSMHVDMADEAYSIGPA-PSQQSYLSMEK 112

  Fly   104 LIRVCKENDVDAVHPGYGFLSERSDFAQAVIDAGLRFIGPSPEVVQKMGDKVAARVAAIEAGVPI 168
            :|:|.|.:...|:|||.|||||..:||:.....|:.||||.|..::.||.|..::.....||||:
Human   113 IIQVAKTSAAQAIHPGCGFLSENMEFAELCKQEGIIFIGPPPSAIRDMGIKSTSKSIMAAAGVPV 177

  Fly   169 VPGTDGPVTTKEEALEFCKKHGLPVIFKAAYGGGGRGMRVVRKMEDVEESFQRASSEAKAAFGNG 233
            |.|..|...:.:...|..::.|.||:.||..||||:|||:||..::.:|..:.|..|||.:|.:.
Human   178 VEGYHGEDQSDQCLKEHARRIGYPVMIKAVRGGGGKGMRIVRSEQEFQEQLESARREAKKSFNDD 242

  Fly   234 AMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPRLPIEIRDKMTEAAV 298
            ||.||||::.|||:|||:.||..||.|:|:||||||||||||::|.||||.:..|:|.|:.||||
Human   243 AMLIEKFVDTPRHVEVQVFGDHHGNAVYLFERDCSVQRRHQKIIEEAPAPGIKSEVRKKLGEAAV 307

  Fly   299 RLARHVGYENAGTVEFLCDESGNFYFIEVNARLQVEHTVTEEITGIDLVQSQIRVAEGMTLPELG 363
            |.|:.|.|..||||||:.|...||.|:|:|.||||||.|||.|||.|||:.|:|:|.|..:|   
Human   308 RAAKAVNYVGAGTVEFIMDSKHNFCFMEMNTRLQVEHPVTEMITGTDLVEWQLRIAAGEKIP--- 369

  Fly   364 YTQDKIVPRGYAIQCRVTTEDPANDFQPNTG--------------RLEVFRSGEGMGIRLDSASA 414
            .:|::|..:|:|.:.|:..|||:|:|.|..|              |:|.       |:|      
Human   370 LSQEEITLQGHAFEARIYAEDPSNNFMPVAGPLVHLSTPRADPSTRIET-------GVR------ 421

  Fly   415 YAGAIISPYYDSLLVKVISHASDLQSSASKMNRALREFRIRGVKTNIPFLLNVLENQKFLHGVLD 479
             .|..:|.:||.::.|::..|:|.|::.:|:..:||::.|.|:.|||.||||:..:.:|..|.:.
Human   422 -QGDEVSVHYDPMIAKLVVWAADRQAALTKLRYSLRQYNIVGLHTNIDFLLNLSGHPEFEAGNVH 485

  Fly   480 TYFIDEH 486
            |.||.:|
Human   486 TDFIPQH 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PCBNP_001163103.1 CPSase_L_chain 39..147 CDD:278706 52/107 (49%)
pyruv_carbox 41..1197 CDD:130302 202/460 (44%)
ATP-grasp_4 153..360 CDD:302634 106/206 (51%)
Biotin_carb_C 377..484 CDD:214878 36/120 (30%)
DRE_TIM_PC_TC_5S 584..867 CDD:163675
PYC_OADA 880..1078 CDD:280576
biotinyl_domain 1130..1196 CDD:133459
MCCC1NP_064551.3 PccA 49..716 CDD:227111 203/462 (44%)
CPSase_L_chain 49..157 CDD:278706 52/108 (48%)
CPSase_L_D2 163..369 CDD:280881 106/205 (52%)
Biotin_carb_C 383..489 CDD:214878 35/119 (29%)
biotinyl_domain 651..714 CDD:133459
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130620at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.