DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1671 and SWD3

DIOPT Version :9

Sequence 1:NP_610526.1 Gene:CG1671 / 36019 FlyBaseID:FBgn0033454 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_009734.1 Gene:SWD3 / 852472 SGDID:S000000379 Length:315 Species:Saccharomyces cerevisiae


Alignment Length:334 Identity:71/334 - (21%)
Similarity:128/334 - (38%) Gaps:86/334 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 CSELK---QLALVTTEQNILVYDVETLEPIKHLV-GYNDEILDMCFMGEHDRYLAVATNSKHFKL 364
            |:::.   |...:|...|||:||:......:.|| .:.....::|:..:..   .:||.|..|.:
Yeast    18 CAKISPDGQFLAITQGLNILIYDINRRTVSQTLVTSHARPFSELCWSPDGQ---CIATASDDFSV 79

  Fly   365 ------YDTEHDMNCKLIVGHSDTVMSLAASQ--NLLISVGKDCSVRLWRLQHDKDCSLEALTQQ 421
                  |...|     ..:||:..|:||..::  |||.:...|.|:::|      |....:|.:.
Yeast    80 EIIHLSYGLLH-----TFIGHTAPVISLTFNRKGNLLFTSSMDESIKIW------DTLNGSLMKT 133

  Fly   422 ANCHTSTIGCVAMTHNGATGFASVSQDGSMKVWQLVRSKEDRNSYSFNLRYAALSHDKEVNCVAY 486
            .:.|:..:..|.:..|.::..:|.|.||.::::.                               
Yeast   134 ISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFD------------------------------- 167

  Fly   487 APNNKLIATASQDKTAKVWLAESNTLQGVLRGHTRGVWSVRFSPVDQIVLTSSSDCTLRIWSISN 551
            |.....:.|.:.||.   |..|:..:.         :..|:||...:.:|..|.|..::||....
Yeast   168 AETGHCLKTLTYDKD---WKRENGVVP---------ISQVKFSENARYLLVKSLDGVVKIWDCIG 220

  Fly   552 FSCIKRFDQ----ECTILR----AEFL--DHGK--FIISAASDGLLKLWNIKTNTCLQSLD---- 600
             .|:.|..|    |..:|.    .:||  :.|.  .:||...:|.:..||..|.:.||.||    
Yeast   221 -GCVVRTFQVQPLEKGVLHHSCGMDFLNPEDGSTPLVISGYENGDIYCWNSDTKSLLQLLDGSLY 284

  Fly   601 EHNDRVWAL 609
            .|:..|.::
Yeast   285 HHSSPVMSI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1671NP_610526.1 WD40 repeat 22..54 CDD:293791
WD40 64..571 CDD:225201 58/288 (20%)
WD40 repeat 82..115 CDD:293791
WD40 118..455 CDD:238121 37/162 (23%)
WD40 repeat 122..159 CDD:293791
WD40 repeat 167..206 CDD:293791
WD40 repeat 209..236 CDD:293791
WD40 repeat 299..335 CDD:293791 10/34 (29%)
WD40 329..631 CDD:238121 63/306 (21%)
WD40 repeat 340..377 CDD:293791 7/42 (17%)
WD40 repeat 430..476 CDD:293791 6/45 (13%)
WD40 repeat 481..517 CDD:293791 6/35 (17%)
WD40 repeat 524..559 CDD:293791 10/34 (29%)
WD40 repeat 564..600 CDD:293791 12/43 (28%)
WD40 repeat 608..657 CDD:293791 0/2 (0%)
Utp13 653..787 CDD:285789
SWD3NP_009734.1 WD40 17..314 CDD:238121 71/334 (21%)
WD40 repeat 17..53 CDD:293791 10/34 (29%)
WD40 repeat 59..94 CDD:293791 7/42 (17%)
WD40 repeat 99..135 CDD:293791 11/41 (27%)
WD40 repeat 142..178 CDD:293791 8/66 (12%)
WD40 repeat 192..228 CDD:293791 10/36 (28%)
WD40 repeat 236..284 CDD:293791 14/47 (30%)
WD40 repeat 290..312 CDD:293791 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1422
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.