| Sequence 1: | NP_610526.1 | Gene: | CG1671 / 36019 | FlyBaseID: | FBgn0033454 | Length: | 787 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_081389.1 | Gene: | Wdr5b / 69544 | MGIID: | 1916794 | Length: | 328 | Species: | Mus musculus |
| Alignment Length: | 294 | Identity: | 68/294 - (23%) |
|---|---|---|---|
| Similarity: | 115/294 - (39%) | Gaps: | 72/294 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 425 HTSTIGCVAMTHNGATGFASVSQDGSMKVWQLVRSKEDRNSYSFNLRYAALSHDKEVNCVAYAPN 489
Fly 490 NKLIATASQDKTAKVWLAESNTLQGVLRGHTRGVWSVRFSPVDQIVLTSSSDCTLRIWSISNFSC 554
Fly 555 IK------------------------RFDQECTILRA--------------------EFLDHGKF 575
Fly 576 IISAASDGLLKLWNIKTNTCLQSLDEHNDRVWAL-----------AVSARSNRFFYTGGADSKLI 629
Fly 630 --RFGDVTQVTRNEALDKRQ-----AALEQEQTL 656 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1671 | NP_610526.1 | WD40 repeat | 22..54 | CDD:293791 | |
| WD40 | 64..571 | CDD:225201 | 41/189 (22%) | ||
| WD40 repeat | 82..115 | CDD:293791 | |||
| WD40 | 118..455 | CDD:238121 | 8/29 (28%) | ||
| WD40 repeat | 122..159 | CDD:293791 | |||
| WD40 repeat | 167..206 | CDD:293791 | |||
| WD40 repeat | 209..236 | CDD:293791 | |||
| WD40 repeat | 299..335 | CDD:293791 | |||
| WD40 | 329..631 | CDD:238121 | 59/262 (23%) | ||
| WD40 repeat | 340..377 | CDD:293791 | |||
| WD40 repeat | 430..476 | CDD:293791 | 9/45 (20%) | ||
| WD40 repeat | 481..517 | CDD:293791 | 11/35 (31%) | ||
| WD40 repeat | 524..559 | CDD:293791 | 8/58 (14%) | ||
| WD40 repeat | 564..600 | CDD:293791 | 14/55 (25%) | ||
| WD40 repeat | 608..657 | CDD:293791 | 15/67 (22%) | ||
| Utp13 | 653..787 | CDD:285789 | 1/4 (25%) | ||
| Wdr5b | NP_081389.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..25 | ||
| WD40 | 31..325 | CDD:238121 | 68/294 (23%) | ||
| WD40 | <34..325 | CDD:225201 | 68/294 (23%) | ||
| WD 1 | 37..76 | 11/47 (23%) | |||
| WD40 repeat | 42..79 | CDD:293791 | 10/46 (22%) | ||
| WD 2 | 79..120 | 13/40 (33%) | |||
| WD40 repeat | 85..121 | CDD:293791 | 12/35 (34%) | ||
| WD 3 | 122..162 | 10/39 (26%) | |||
| WD40 repeat | 126..162 | CDD:293791 | 9/35 (26%) | ||
| WD 4 | 163..202 | 4/38 (11%) | |||
| WD40 repeat | 169..204 | CDD:293791 | 4/34 (12%) | ||
| DDB1-binding motif | 186..190 | 1/3 (33%) | |||
| WD 5 | 206..247 | 12/40 (30%) | |||
| WD40 repeat | 211..247 | CDD:293791 | 12/35 (34%) | ||
| WD 6 | 250..290 | 6/39 (15%) | |||
| WD40 repeat | 255..292 | CDD:293791 | 7/36 (19%) | ||
| WD 7 | 293..328 | 8/29 (28%) | |||
| WD40 repeat | 298..324 | CDD:293791 | 6/24 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1422 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.940 | |||||