| Sequence 1: | NP_610526.1 | Gene: | CG1671 / 36019 | FlyBaseID: | FBgn0033454 | Length: | 787 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001245503.1 | Gene: | wds / 53428 | FlyBaseID: | FBgn0040066 | Length: | 361 | Species: | Drosophila melanogaster |
| Alignment Length: | 298 | Identity: | 64/298 - (21%) |
|---|---|---|---|
| Similarity: | 115/298 - (38%) | Gaps: | 80/298 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 425 HTSTIGCVAMTHNGATGFASVSQDGSMKVWQLVRSKEDRNSYSFNLRYAALSHDKEVNCVAYAPN 489
Fly 490 NKLIATASQDKTAKVWLAESNTLQGVLRGHTRGVWSVRFSPVDQIVLTSSSDCTLRIWSISNFSC 554
Fly 555 IK------------------------RFDQECTI--------LR------------AEFLDHGKF 575
Fly 576 IISAASDGLLKLWNIKTNTCLQSLDEHNDRVWALAV--SARSNRFFYTGGADSKLIRFGDVTQVT 638
Fly 639 RNEALDKRQ--------------------AALEQEQTL 656 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1671 | NP_610526.1 | WD40 repeat | 22..54 | CDD:293791 | |
| WD40 | 64..571 | CDD:225201 | 41/189 (22%) | ||
| WD40 repeat | 82..115 | CDD:293791 | |||
| WD40 | 118..455 | CDD:238121 | 10/29 (34%) | ||
| WD40 repeat | 122..159 | CDD:293791 | |||
| WD40 repeat | 167..206 | CDD:293791 | |||
| WD40 repeat | 209..236 | CDD:293791 | |||
| WD40 repeat | 299..335 | CDD:293791 | |||
| WD40 | 329..631 | CDD:238121 | 56/251 (22%) | ||
| WD40 repeat | 340..377 | CDD:293791 | |||
| WD40 repeat | 430..476 | CDD:293791 | 10/45 (22%) | ||
| WD40 repeat | 481..517 | CDD:293791 | 10/35 (29%) | ||
| WD40 repeat | 524..559 | CDD:293791 | 9/58 (16%) | ||
| WD40 repeat | 564..600 | CDD:293791 | 14/55 (25%) | ||
| WD40 repeat | 608..657 | CDD:293791 | 11/71 (15%) | ||
| Utp13 | 653..787 | CDD:285789 | 1/4 (25%) | ||
| wds | NP_001245503.1 | WD40 | 64..358 | CDD:238121 | 64/298 (21%) |
| WD40 repeat | 75..112 | CDD:293791 | 10/46 (22%) | ||
| WD40 repeat | 118..154 | CDD:293791 | 11/35 (31%) | ||
| WD40 repeat | 159..195 | CDD:293791 | 10/35 (29%) | ||
| WD40 repeat | 202..237 | CDD:293791 | 4/34 (12%) | ||
| WD40 repeat | 244..280 | CDD:293791 | 12/35 (34%) | ||
| WD40 repeat | 288..325 | CDD:293791 | 5/40 (13%) | ||
| WD40 repeat | 331..357 | CDD:293791 | 5/24 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1422 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.940 | |||||