Sequence 1: | NP_610526.1 | Gene: | CG1671 / 36019 | FlyBaseID: | FBgn0033454 | Length: | 787 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001011411.1 | Gene: | wdr5 / 496891 | XenbaseID: | XB-GENE-493883 | Length: | 334 | Species: | Xenopus tropicalis |
Alignment Length: | 298 | Identity: | 65/298 - (21%) |
---|---|---|---|
Similarity: | 115/298 - (38%) | Gaps: | 80/298 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 425 HTSTIGCVAMTHNGATGFASVSQDGSMKVWQLVRSKEDRNSYSFNLRYAALSHDKEVNCVAYAPN 489
Fly 490 NKLIATASQDKTAKVWLAESNTLQGVLRGHTRGVWSVRFSPVDQIVLTSSSDCTLRIWSISNFSC 554
Fly 555 IK------------------------RFDQECTI--------LR------------AEFLDHGKF 575
Fly 576 IISAASDGLLKLWNIKTNTCLQSLDEHNDRVWALAV--SARSNRFFYTGGADSKLIRFGDVTQVT 638
Fly 639 RNEALDKRQ--------------------AALEQEQTL 656 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1671 | NP_610526.1 | WD40 repeat | 22..54 | CDD:293791 | |
WD40 | 64..571 | CDD:225201 | 42/189 (22%) | ||
WD40 repeat | 82..115 | CDD:293791 | |||
WD40 | 118..455 | CDD:238121 | 10/29 (34%) | ||
WD40 repeat | 122..159 | CDD:293791 | |||
WD40 repeat | 167..206 | CDD:293791 | |||
WD40 repeat | 209..236 | CDD:293791 | |||
WD40 repeat | 299..335 | CDD:293791 | |||
WD40 | 329..631 | CDD:238121 | 57/251 (23%) | ||
WD40 repeat | 340..377 | CDD:293791 | |||
WD40 repeat | 430..476 | CDD:293791 | 10/45 (22%) | ||
WD40 repeat | 481..517 | CDD:293791 | 11/35 (31%) | ||
WD40 repeat | 524..559 | CDD:293791 | 9/58 (16%) | ||
WD40 repeat | 564..600 | CDD:293791 | 14/55 (25%) | ||
WD40 repeat | 608..657 | CDD:293791 | 11/71 (15%) | ||
Utp13 | 653..787 | CDD:285789 | 1/4 (25%) | ||
wdr5 | NP_001011411.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..32 | ||
WD40 | 37..331 | CDD:238121 | 65/298 (22%) | ||
WD 1 | 43..82 | 12/47 (26%) | |||
WD40 repeat | 48..85 | CDD:293791 | 10/46 (22%) | ||
WD 2 | 85..126 | 12/40 (30%) | |||
WD40 repeat | 91..127 | CDD:293791 | 12/35 (34%) | ||
WD 3 | 128..168 | 11/39 (28%) | |||
WD40 repeat | 132..168 | CDD:293791 | 10/35 (29%) | ||
WD 4 | 169..208 | 4/38 (11%) | |||
WD40 repeat | 175..210 | CDD:293791 | 4/34 (12%) | ||
WD 5 | 212..253 | 12/40 (30%) | |||
WD40 repeat | 217..253 | CDD:293791 | 12/35 (34%) | ||
WD 6 | 256..296 | 4/43 (9%) | |||
WD40 repeat | 261..298 | CDD:293791 | 5/40 (13%) | ||
WD 7 | 299..333 | 5/29 (17%) | |||
WD40 repeat | 304..330 | CDD:293791 | 5/24 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1422 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |