Sequence 1: | NP_610526.1 | Gene: | CG1671 / 36019 | FlyBaseID: | FBgn0033454 | Length: | 787 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610702.1 | Gene: | CG13192 / 36259 | FlyBaseID: | FBgn0033653 | Length: | 323 | Species: | Drosophila melanogaster |
Alignment Length: | 316 | Identity: | 60/316 - (18%) |
---|---|---|---|
Similarity: | 109/316 - (34%) | Gaps: | 85/316 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 343 MCFMGEHDRYLAVATNSKHFKLYDTEHDMNCKLIVGHSDTVMSLAASQNLLISVGKDCSVRLWRL 407
Fly 408 -------------QHDKDC--SLEALTQQAN-------CHTSTIGCVAMTHNGA----------- 439
Fly 440 ----------TGFASVSQ--------DGSMKVWQLVRS--------KEDRNSYSFNLRYAALSHD 478
Fly 479 KEVN-CVAYAPNNKLIATASQDKTAKVWLAESNTLQGVLRGHTRGVWSVRFSPVDQIVLTSSSDC 542
Fly 543 TLRIWSISNFSCIKRFDQECT--ILRAEF------LDHGKFIISAASDGLLKLWNI 590 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1671 | NP_610526.1 | WD40 repeat | 22..54 | CDD:293791 | |
WD40 | 64..571 | CDD:225201 | 54/295 (18%) | ||
WD40 repeat | 82..115 | CDD:293791 | |||
WD40 | 118..455 | CDD:238121 | 31/162 (19%) | ||
WD40 repeat | 122..159 | CDD:293791 | |||
WD40 repeat | 167..206 | CDD:293791 | |||
WD40 repeat | 209..236 | CDD:293791 | |||
WD40 repeat | 299..335 | CDD:293791 | |||
WD40 | 329..631 | CDD:238121 | 60/316 (19%) | ||
WD40 repeat | 340..377 | CDD:293791 | 10/33 (30%) | ||
WD40 repeat | 430..476 | CDD:293791 | 11/82 (13%) | ||
WD40 repeat | 481..517 | CDD:293791 | 7/36 (19%) | ||
WD40 repeat | 524..559 | CDD:293791 | 7/34 (21%) | ||
WD40 repeat | 564..600 | CDD:293791 | 7/33 (21%) | ||
WD40 repeat | 608..657 | CDD:293791 | |||
Utp13 | 653..787 | CDD:285789 | |||
CG13192 | NP_610702.1 | WD40 | <5..321 | CDD:225201 | 60/314 (19%) |
WD40 repeat | 62..98 | CDD:293791 | 4/35 (11%) | ||
WD40 repeat | 103..147 | CDD:293791 | 10/43 (23%) | ||
WD40 repeat | 200..245 | CDD:293791 | 9/59 (15%) | ||
WD40 | 201..>321 | CDD:295369 | 26/134 (19%) | ||
WD40 repeat | 247..282 | CDD:293791 | 7/34 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR19854 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |