DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1671 and swd3

DIOPT Version :9

Sequence 1:NP_610526.1 Gene:CG1671 / 36019 FlyBaseID:FBgn0033454 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_595227.1 Gene:swd3 / 2540929 PomBaseID:SPBC354.03 Length:380 Species:Schizosaccharomyces pombe


Alignment Length:349 Identity:78/349 - (22%)
Similarity:152/349 - (43%) Gaps:67/349 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 HTSTIGCVAMTHNGATGFASVSQDGSMKVWQLVRSKEDRNSYSFNLRYAALSHDKEVNCVAYAPN 489
            |..::.||:::.| ....|:.|.||::|:|         ::.:|.|......|.:.::.|.:|..
pombe    53 HEKSVTCVSVSPN-KRWIATSSSDGTIKIW---------SALTFRLECTLFGHYRGISQVKWATG 107

  Fly   490 NKLIATASQDKTAKVWLAESNTLQGVLRGHTRGVWSVRFSPVDQIVLTSSSDCTLRIWSISNFSC 554
            :|.:|:||.|||.::|..|.......|:|||..|.|:.|:|:..::::.|.|.|:|||::.:.:|
pombe   108 SKYLASASDDKTIRIWDFEKRCSVRCLKGHTNYVSSIDFNPLGTLLVSGSWDETVRIWNLQDGTC 172

  Fly   555 IKRFDQEC-TILRAEFLDHGKFIISAASDGLLKLWNIKTNTCLQSLDE-----------HNDRVW 607
            ::...... .|:.......|....:|:.||:.::|::.:..||::|.|           ..:|.:
pombe   173 LRMLPAHSEPIISVSISADGTLCATASYDGMARIWDVLSGQCLKTLVEPINVPLSNLQFTENRKY 237

  Fly   608 ALAVSARSNRFFYTGGADSKLIRFGDVTQVTR----------------NEALDKRQAALEQEQTL 656
             |.||..:::........::::|..|....||                .|||....::...:   
pombe   238 -LLVSNLNSQIRLWDYRRNRVVRIFDSHVNTRYSMSWDCYSSKNIPKNTEALPNNDSSYPDD--- 298

  Fly   657 HSLLHAQKQLHKAFVL------ALNLDKPKASFDIINHFVRKRDEPGLRQLVDQLNVDQRVALL- 714
                 |:..:|.|::|      .:.:..|.... ||:..:|..|:|.    ...|||......: 
pombe   299 -----AESFMHDAYLLIPSEDGTIQITDPSTKI-IIDDSIRHSDDPE----TSLLNVTSLGPFII 353

  Fly   715 -----QHVKAWTTN---SRHSQAG 730
                 .:|:.|..:   |:|.:.|
pombe   354 TSGTDPYVRVWAPSLLLSKHEKDG 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1671NP_610526.1 WD40 repeat 22..54 CDD:293791
WD40 64..571 CDD:225201 40/146 (27%)
WD40 repeat 82..115 CDD:293791
WD40 118..455 CDD:238121 9/29 (31%)
WD40 repeat 122..159 CDD:293791
WD40 repeat 167..206 CDD:293791
WD40 repeat 209..236 CDD:293791
WD40 repeat 299..335 CDD:293791
WD40 329..631 CDD:238121 53/217 (24%)
WD40 repeat 340..377 CDD:293791
WD40 repeat 430..476 CDD:293791 11/45 (24%)
WD40 repeat 481..517 CDD:293791 11/35 (31%)
WD40 repeat 524..559 CDD:293791 10/34 (29%)
WD40 repeat 564..600 CDD:293791 8/35 (23%)
WD40 repeat 608..657 CDD:293791 10/64 (16%)
Utp13 653..787 CDD:285789 18/93 (19%)
swd3NP_595227.1 WD40 5..379 CDD:225201 78/349 (22%)
WD40 46..365 CDD:238121 74/335 (22%)
WD40 repeat 57..94 CDD:293791 11/46 (24%)
WD40 repeat 100..136 CDD:293791 12/35 (34%)
WD40 repeat 141..177 CDD:293791 11/35 (31%)
WD40 repeat 184..219 CDD:293791 7/34 (21%)
WD40 repeat 226..262 CDD:293791 5/36 (14%)
WD40 repeat 269..333 CDD:293791 10/72 (14%)
WD40 repeat 339..364 CDD:293791 4/28 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1422
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.