DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1671 and wdr-5.1

DIOPT Version :9

Sequence 1:NP_610526.1 Gene:CG1671 / 36019 FlyBaseID:FBgn0033454 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_497749.1 Gene:wdr-5.1 / 175474 WormBaseID:WBGene00006474 Length:376 Species:Caenorhabditis elegans


Alignment Length:284 Identity:63/284 - (22%)
Similarity:123/284 - (43%) Gaps:36/284 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 AVATNSKHFKLYDTEHDMNCKLIVGHSDTVMSLAASQ--NLLISVGKDCSVRLWRLQH---DKDC 413
            |.|:.|.::||..|        :.||:.::.|...|.  ..|.:...|.:|::|.:.|   ::..
 Worm    69 ASASGSANYKLMCT--------LEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTL 125

  Fly   414 SLEALTQQANCHTSTIGCVAMTHNGATGFASVSQDGSMKVWQLVRSKEDRNSYSFNLRYAALSHD 478
            :...|.......:|...||          .|.|.|.::|::::|.|:         :......|:
 Worm   126 TGHKLGVNDIAWSSDSRCV----------VSASDDKTLKIFEIVTSR---------MTKTLKGHN 171

  Fly   479 KEVNCVAYAPNNKLIATASQDKTAKVWLAESNTLQGVLRGHTRGVWSVRFSPVDQIVLTSSSDCT 543
            ..|.|..:.|.:.|:.:.|.|::.::|..::......|..|:..|.:|.|:....::.:.|.|..
 Worm   172 NYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGL 236

  Fly   544 LRIWSISNFSCIKRF--DQECTILRAEFLDHGKFIISAASDGLLKLWNIKTNTCLQSLDEHNDRV 606
            :|||..:|..|||..  |:...:...:|..:||:|:::..|..||||:......|:....|.:..
 Worm   237 VRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSK 301

  Fly   607 WALAV--SARSNRFFYTGGADSKL 628
            :.:..  |....::..:|..|.|:
 Worm   302 YCIFANFSVTGGKWIISGSEDCKI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1671NP_610526.1 WD40 repeat 22..54 CDD:293791
WD40 64..571 CDD:225201 49/223 (22%)
WD40 repeat 82..115 CDD:293791
WD40 118..455 CDD:238121 23/105 (22%)
WD40 repeat 122..159 CDD:293791
WD40 repeat 167..206 CDD:293791
WD40 repeat 209..236 CDD:293791
WD40 repeat 299..335 CDD:293791
WD40 329..631 CDD:238121 63/284 (22%)
WD40 repeat 340..377 CDD:293791 6/22 (27%)
WD40 repeat 430..476 CDD:293791 8/45 (18%)
WD40 repeat 481..517 CDD:293791 7/35 (20%)
WD40 repeat 524..559 CDD:293791 11/36 (31%)
WD40 repeat 564..600 CDD:293791 10/35 (29%)
WD40 repeat 608..657 CDD:293791 4/23 (17%)
Utp13 653..787 CDD:285789
wdr-5.1NP_497749.1 WD40 <76..372 CDD:225201 60/277 (22%)
WD40 79..373 CDD:238121 59/274 (22%)
WD40 repeat 90..127 CDD:293791 7/36 (19%)
WD40 repeat 133..169 CDD:293791 9/54 (17%)
WD40 repeat 174..210 CDD:293791 7/35 (20%)
WD40 repeat 217..252 CDD:293791 11/34 (32%)
WD40 repeat 259..295 CDD:293791 10/35 (29%)
WD40 repeat 303..340 CDD:293791 4/23 (17%)
WD40 repeat 346..372 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1422
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.