DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and PRE1

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_010928.1 Gene:PRE1 / 856731 SGDID:S000000814 Length:198 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:50/209 - (23%)
Similarity:89/209 - (42%) Gaps:62/209 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIGIRGKDAVVLAVEKIIT---SKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAAN 98
            ::|||.:|:|:||..|.:|   |.|.:.|...|  .:..:..|:.||...|....|:..:.....
Yeast     4 ILGIRVQDSVILASSKAVTRGISVLKDSDDKTR--QLSPHTLMSFAGEAGDTVQFAEYIQANIQL 66

  Fly    99 Y--RQQFE---QAIPLKHLCHRVAGYVH---AYTLYSAVRPFGLSIILASWDEVEG-PQLYKIE- 153
            |  |:.:|   ||         |:.:|.   |.::.|. ||:.:::::..:|:.:. |:||:|: 
Yeast    67 YSIREDYELSPQA---------VSSFVRQELAKSIRSR-RPYQVNVLIGGYDKKKNKPELYQIDY 121

  Fly   154 -------PSG----SSFGYFACASGKAK------------QLAKTEMEK-LKMDMRTDELVESAG 194
                   |.|    |.|..|:......:            :|...|:|| :.||.:        |
Yeast   122 LGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFK--------G 178

  Fly   195 EIIYKVHDELKDKD 208
            .|:     ::.|||
Yeast   179 VIV-----KIVDKD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 50/209 (24%)
PRE1 6..231 CDD:223711 50/209 (24%)
PRE1NP_010928.1 proteasome_beta_type_2 1..194 CDD:239727 50/209 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.