DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and PRE2

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_015428.1 Gene:PRE2 / 856218 SGDID:S000006307 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:239 Identity:46/239 - (19%)
Similarity:80/239 - (33%) Gaps:76/239 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIF--TIEKNIGM-- 76
            :||.::        .:....|.:..|.:..:::||:...|       ||..:.  |::|.|.:  
Yeast    65 NPDCKI--------KIAHGTTTLAFRFQGGIIVAVDSRAT-------AGNWVASQTVKKVIEINP 114

  Fly    77 ----AVAGLVADGNF----VADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFG 133
                .:||..||..|    :....|......:::...|...|.|.:.|..|..|          |
Yeast   115 FLLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGA----------G 169

  Fly   134 LSI--ILASWDEVEGPQLYKIEP-------------SGSSFGYFACAS--------------GKA 169
            ||:  ::..:...|||.:|.::.             ||.:|.|....|              ||.
Yeast   170 LSMGTMICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKR 234

  Fly   170 KQLAKTEMEKLK------MDMRTDELV----ESAGEIIYKVHDE 203
            ..||....:...      ..:..|..:    ...||:.:||.:|
Yeast   235 SILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKVKEE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 46/239 (19%)
PRE1 6..231 CDD:223711 46/239 (19%)
PRE2NP_015428.1 proteasome_beta_type_5 76..264 CDD:239730 39/204 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.