DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and PRE7

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_009512.1 Gene:PRE7 / 852239 SGDID:S000000137 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:268 Identity:61/268 - (22%)
Similarity:101/268 - (37%) Gaps:80/268 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTIGTGYDLSAS------QFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLA------VEKI 53
            |:||.:.|...||      ||:|.|            :..||::||.|:|..|||      .:..
Yeast     1 MATIASEYSSEASNTPIEHQFNPYG------------DNGGTILGIAGEDFAVLAGDTRNITDYS 53

  Fly    54 ITSKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAG 118
            |.|: |||    ::|....||.|:..|..|||:.:.           ::|:.::...|..|.   
Yeast    54 INSR-YEP----KVFDCGDNIVMSANGFAADGDALV-----------KRFKNSVKWYHFDHN--- 99

  Fly   119 YVHAYTLYSAVR------------PFGLSIILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQ 171
             ....::.||.|            |:.:..|:|..||.....:|..:|.| |:....|.:|.|  
Yeast   100 -DKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKGAVYSFDPVG-SYEREQCRAGGA-- 160

  Fly   172 LAKTEMEKLKMDMRTDELVESAGEIIYKVHDELKDKDFRFEMGLVGRVTGGLHLINPSELTEKAR 236
                                 |..:|....|...:...::|.|..|:|...|..::..|:.:..|
Yeast   161 ---------------------AASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKLVR 204

  Fly   237 KAGDAANK 244
            .:..:|.:
Yeast   205 DSFTSATE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 52/234 (22%)
PRE1 6..231 CDD:223711 55/248 (22%)
PRE7NP_009512.1 proteasome_beta_type_1 21..241 CDD:239726 54/248 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.