DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and PAE1

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001077717.1 Gene:PAE1 / 841822 AraportID:AT1G53850 Length:237 Species:Arabidopsis thaliana


Alignment Length:234 Identity:79/234 - (33%)
Similarity:125/234 - (53%) Gaps:17/234 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TGYDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTI 70
            |.||...:.|||:||:||::||.:|::...|.||::.|:.|||||||.|||.|.||.:..:|..|
plant     6 TEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGVKTKEGVVLAVEKRITSPLLEPSSVEKIMEI 70

  Fly    71 EKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKH----LCHRVAGYVHAYTLYSAVRP 131
            :.:||.|::||:||...:.:.||.|..|:|..:.:.:.::.    ||.....:..... .|..||
plant    71 DDHIGCAMSGLIADARTLVEHARVETQNHRFSYGEPMTVESTTQALCDLALRFGEGEE-ESMSRP 134

  Fly   132 FGLSIILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEM-EKLKMDMRTDELVESAGE 195
            ||:|:::|..|| .||.||..:|||:.:...|.|.|...:.|.:.: |:...|:...|....|..
plant   135 FGVSLLIAGHDE-NGPSLYYTDPSGTFWQCNAKAIGSGSEGADSSLQEQFNKDLSLQEAETIAVS 198

  Fly   196 IIYKVHDEL---KDKDFRFEMGLVGRVTGGLHLINPSEL 231
            |:.:|.:|.   .:.|       :.:|....||..|.|:
plant   199 ILKQVMEEKVTPNNVD-------IAKVAPAYHLYTPQEV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 74/217 (34%)
PRE1 6..231 CDD:223711 78/232 (34%)
PAE1NP_001077717.1 proteasome_alpha_type_5 8..218 CDD:239722 73/218 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.