DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and PAF2

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_175158.1 Gene:PAF2 / 841128 AraportID:AT1G47250 Length:277 Species:Arabidopsis thaliana


Alignment Length:251 Identity:76/251 - (30%)
Similarity:124/251 - (49%) Gaps:21/251 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEK 72
            ||...:.:||.||:||::||.:||::....||:|.:..||||......|:|.....  :||.::.
plant     6 YDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQR--KIFKVDD 68

  Fly    73 NIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSII 137
            :||:|:|||.|||..::...|.|:.|:...:|..:|:..|...:|......|..|..||:|:.::
plant    69 HIGVAIAGLTADGRVLSRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRPYGVGLL 133

  Fly   138 LASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEIIYK--- 199
            :...|| .|..||...|||:.|.|.|.|.|...|.|||.:|:     :.:...||:.|.:.|   
plant   134 VGGLDE-SGAHLYYNCPSGNYFEYQAFAIGSRSQAAKTYLER-----KFESFQESSKEDLIKDAI 192

  Fly   200 --VHDELKDKDFRFEMGLVG--RVTGGLHLINPSELTEKARKAGDAANK--DEDSD 249
              :.:.|:.:..:..:..|.  .|....|.::    .|..:|..|...|  :|:.|
plant   193 MAIRETLQGETLKSSLCTVSVLGVDEPFHFLD----QESIQKVIDTFEKVPEEEED 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 67/212 (32%)
PRE1 6..231 CDD:223711 70/229 (31%)
PAF2NP_175158.1 proteasome_alpha_type_1 6..215 CDD:239718 68/216 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.