DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and psma6l

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_571870.2 Gene:psma6l / 83917 ZFINID:ZDB-GENE-010502-2 Length:252 Species:Danio rerio


Alignment Length:197 Identity:65/197 - (32%)
Similarity:105/197 - (53%) Gaps:10/197 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GYDLSASQFSPDGRVFQIDYASKAVEKSG-TVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTI 70
            |:|...:.|||:||::|::||.||:.:|| |.:||||.|..||..:|.::..|.:......:|.|
Zfish     8 GFDRHITIFSPEGRLYQVEYAFKAISQSGLTTVGIRGVDCAVLVTQKKVSDTLLDASTMTNMFRI 72

  Fly    71 EKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLS 135
            ...||..:.|..||.......||.||..::.:|...:|:..||.|:|.....||..:.:||.|..
Zfish    73 TPRIGCVMTGHYADSRSQVHRARIEAGEWKYKFGYDVPVDALCRRLADLSQVYTQNAEMRPLGCC 137

  Fly   136 IILASWDEVEGPQLYKIEPSGSSFGYFACASG---------KAKQLAKTEMEKLKMDMRTDELVE 191
            ::|.|.|..:||.|||.:|:|...|:.|.:.|         ..|::.|.:.:|.::::..|..|:
Zfish   138 MMLISMDPQKGPMLYKCDPAGYFCGFRATSVGVKHTEANSYLEKKIKKMQKKKEEVELDFDSSVQ 202

  Fly   192 SA 193
            .|
Zfish   203 MA 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 65/197 (33%)
PRE1 6..231 CDD:223711 65/197 (33%)
psma6lNP_571870.2 PRE1 7..252 CDD:223711 65/197 (33%)
proteasome_alpha_type_6 8..226 CDD:239723 65/197 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.