DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and PAB1

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001031057.1 Gene:PAB1 / 838217 AraportID:AT1G16470 Length:235 Species:Arabidopsis thaliana


Alignment Length:238 Identity:76/238 - (31%)
Similarity:127/238 - (53%) Gaps:26/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEK 72
            |..|.:.|||.|::.||::|..||....|.:||:..:.||:|.||.:.|.|.:..:..:|..:..
plant     6 YSFSLTTFSPSGKLVQIEHALTAVGSGQTSLGIKASNGVVIATEKKLPSILVDEASVQKIQHLTP 70

  Fly    73 NIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSII 137
            |||:..:|:..|...:...:|::|..|.:.:::.||:..|....|..:..:|....|||||:|::
plant    71 NIGVVYSGMGPDFRVLVRKSRKQAEQYLRLYKEPIPVTQLVRETATVMQEFTQSGGVRPFGVSLL 135

  Fly   138 LASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEK-LKMDMRTDELVESA-------- 193
            :|.:|: :|||||:::||||.|.:.|.|.||....|||.:|| ...||..|:.:.:|        
plant   136 VAGYDD-KGPQLYQVDPSGSYFSWKASAMGKNVSNAKTFLEKRYTEDMELDDAIHTAILTLKEGF 199

  Fly   194 -GEIIYKVHDELKDKDFRFEMGLVG--RVTGGLHLINPSELTE 233
             |||..|          ..|:|.:|  :|   ..::.|:|:.:
plant   200 EGEISSK----------NIEIGKIGADKV---FRVLTPAEIDD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 72/217 (33%)
PRE1 6..231 CDD:223711 75/234 (32%)
PAB1NP_001031057.1 proteasome_alpha_type_2 6..232 CDD:239719 76/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.