DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and PBF1

DIOPT Version :10

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_191641.1 Gene:PBF1 / 825253 AraportID:AT3G60820 Length:223 Species:Arabidopsis thaliana


Alignment Length:190 Identity:38/190 - (20%)
Similarity:66/190 - (34%) Gaps:25/190 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GTVIGIRGKDAVVLAVEK------IITSKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVADIAR 93
            ||.:.|.|.|..|:|.:.      .|.|:.|     .:|..:.....::.:|..||...:..:.:
plant    16 GTCVAIAGSDYCVIAADTRMSTGYSILSRDY-----SKIHKLADRAVLSSSGFQADVKALQKVLK 75

  Fly    94 QEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSIILASWDEVEGPQLYKIEPSGS- 157
            .....|:.|..:.:.    |..:|..:.....:....|:....:|...||.....::..:..|| 
plant    76 SRHLIYQHQHNKQMS----CPAMAQLLSNTLYFKRFFPYYAFNVLGGLDEEGKGCVFTYDAVGSY 136

  Fly   158 -SFGYFACASGKA-------KQLAKTEMEKL-KMDMRTDELVESAGEIIYKVHDELKDKD 208
             ..||.|..||..       .||.......| |.|..|......|.:::..|.....::|
plant   137 ERVGYGAQGSGSTLIMPFLDNQLKSPSPLLLPKQDSNTPLSEAEAVDLVKTVFASATERD 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 38/190 (20%)
PBF1NP_191641.1 proteasome_beta_type_1 8..223 CDD:239726 38/190 (20%)

Return to query results.
Submit another query.