DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and PAD1

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_190694.1 Gene:PAD1 / 824289 AraportID:AT3G51260 Length:250 Species:Arabidopsis thaliana


Alignment Length:255 Identity:82/255 - (32%)
Similarity:131/255 - (51%) Gaps:32/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEK 72
            ||.:.:.|||||.:||::||.:||.|....:|:||.|.|||||||..|.||.:..:..:|.:::.
plant     4 YDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSARKIVSLDN 68

  Fly    73 NIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSII 137
            :|.:|.|||.||...:.:.||.|..::|...|..:.::::...:||....||....|||||||.:
plant    69 HIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTL 133

  Fly   138 LASWDE-VEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEK----------LKMDMRT-DELV 190
            :..:|. ...|.||:.:|||:...:.|.|:|:.....:..:||          :|:.:|. .|:|
plant   134 IVGFDPYTRIPALYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKESAGQETVKLAIRALLEVV 198

  Fly   191 ESAGEIIYKVHDELKDKDFRFEMGLVGRVTGGLHLINPSEL------TEKARKAGDAANK 244
            ||.|:.|              |:.::.|..|.|..:...|:      .|..:.|.:||.|
plant   199 ESGGKNI--------------EVAVMTREEGVLKQLEEEEIDIIVAEIEAEKAAAEAAKK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 73/219 (33%)
PRE1 6..231 CDD:223711 76/234 (32%)
PAD1NP_190694.1 proteasome_alpha_type_7 4..210 CDD:239724 73/219 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.