DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and PBD1

DIOPT Version :10

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_188902.1 Gene:PBD1 / 821834 AraportID:AT3G22630 Length:204 Species:Arabidopsis thaliana


Alignment Length:182 Identity:39/182 - (21%)
Similarity:78/182 - (42%) Gaps:29/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIGIRGKD-AVVLAVEKIITSKLYEPDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAANYR 100
            |.|:.|.. |:|.|....:.|.|...:...:|..::.:..:|.:|...|.....:..::..:.|:
plant     4 VFGLVGNGFAIVAADTSAVHSILLHKNNEDKIMVLDSHKLVAASGEPGDRVQFTEYVQKNVSLYK 68

  Fly   101 QQFEQAIPLKHLCHRVAGYVHAYTLYSAVR--PFGLSIILASWDEVEGPQLY---------KIEP 154
              |...|||....  .|.:... .|.:|:|  |:.::|::|.:|:..|..||         |::.
plant    69 --FRNGIPLTTAA--AANFTRG-ELATALRKNPYSVNILMAGYDDESGASLYYIDYIATLHKVDK 128

  Fly   155 SGSSFG-YFACASGKAKQLAKTEMEK-LKMDMRTDELVESAGEIIYKVHDEL 204
            ....:| ||:.::          |:: .:.||..:|.:|...:.|.::...|
plant   129 GAFGYGSYFSLST----------MDRHYRSDMSVEEAIELVDKCILEIRSRL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 39/182 (21%)
PBD1NP_188902.1 proteasome_beta_type_2 1..192 CDD:239727 39/182 (21%)

Return to query results.
Submit another query.