DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and PAC1

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_188850.1 Gene:PAC1 / 821774 AraportID:AT3G22110 Length:250 Species:Arabidopsis thaliana


Alignment Length:237 Identity:79/237 - (33%)
Similarity:132/237 - (55%) Gaps:5/237 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGG-RIFTIE 71
            ||...:.|||:||::|::||.:|:..:|:.|||..||.|||..||.:||||.:..... :::.|:
plant     5 YDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILSKDGVVLIGEKKVTSKLLQTSTSAEKMYKID 69

  Fly    72 KNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSI 136
            .::..||||:::|.|.:.:.||.:|..|...:::.:|::.|...:......||.:..:||||:|.
plant    70 DHVACAVAGIMSDANILINTARVQAQRYTFMYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSF 134

  Fly   137 ILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEK-LKMDMRTDELVESAGEIIYKV 200
            :.|.||:..|.|||..:|||:..|:.|.|.|...|.|::.::: .|.|...:|.||.|.:::.|.
plant   135 LFAGWDKHHGFQLYMSDPSGNYGGWKAAAVGANNQAAQSILKQDYKDDATREEAVELALKVLTKT 199

  Fly   201 HDELKDKDFRFEMG---LVGRVTGGLHLINPSELTEKARKAG 239
            .|.......:.|:.   |....|...|:.:|..||:...|.|
plant   200 MDSTSLTSEKLELAEVYLTPSKTVKYHVHSPESLTKLLVKHG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 71/212 (33%)
PRE1 6..231 CDD:223711 75/227 (33%)
PAC1NP_188850.1 proteasome_alpha_type_4 3..215 CDD:239721 71/209 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.