DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and PSMB8

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_683720.2 Gene:PSMB8 / 5696 HGNCID:9545 Length:276 Species:Homo sapiens


Alignment Length:184 Identity:39/184 - (21%)
Similarity:69/184 - (37%) Gaps:45/184 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DG-RVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEKN-------- 73
            || |..||:.|     ...|.:..:.:..|:.||:.       ...||..|..:..|        
Human    60 DGERNVQIEMA-----HGTTTLAFKFQHGVIAAVDS-------RASAGSYISALRVNKVIEINPY 112

  Fly    74 -IGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSI- 136
             :| .::|..||..:...:..:|...|..:..:.|.:......::..:..|      |..|||: 
Human   113 LLG-TMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQY------RGMGLSMG 170

  Fly   137 -ILASWDEVEGPQLYKIEP-------------SGSSFGYFACASGKAKQLAKTE 176
             ::..||: :||.||.::.             ||:::.|....||....|:..|
Human   171 SMICGWDK-KGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 39/184 (21%)
PRE1 6..231 CDD:223711 39/184 (21%)
PSMB8NP_683720.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
proteasome_beta_type_5 73..260 CDD:239730 33/166 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.