DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and PSMB7

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_002790.1 Gene:PSMB7 / 5695 HGNCID:9544 Length:277 Species:Homo sapiens


Alignment Length:201 Identity:54/201 - (26%)
Similarity:75/201 - (37%) Gaps:46/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VFQIDYASKA-----VEKSGTVI-GIRGKDAVVLAVEKIITSKLYEPDAG-GRIFTIEKNIGMAV 78
            |.:.|:|.:.     |.|:||.| |:..||.:||..:...|..:...|.. .:|..|..||....
Human    24 VLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCG 88

  Fly    79 AGLVADGNFVAD---------------IARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSA 128
            ||..||.:....               :.|...||..        ||.:..|..||:        
Human    89 AGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRM--------LKQMLFRYQGYI-------- 137

  Fly   129 VRPFGLSIILASWDEVEGPQLYKIEPSGSS--FGYFACASGKAKQLAKTEMEKLKMDMRTDELVE 191
                |.:::|...| |.||.||.|.|.||:  ..|....||....:|..| :|.:.||..:|...
Human   138 ----GAALVLGGVD-VTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFE-DKFRPDMEEEEAKN 196

  Fly   192 SAGEII 197
            ...|.|
Human   197 LVSEAI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 54/201 (27%)
PRE1 6..231 CDD:223711 54/201 (27%)
PSMB7NP_002790.1 proteasome_beta_type_7 44..232 CDD:239732 48/181 (27%)
Pr_beta_C 236..271 CDD:403609
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.