DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and psma2a

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001019612.1 Gene:psma2a / 554153 ZFINID:ZDB-GENE-050522-479 Length:234 Species:Danio rerio


Alignment Length:228 Identity:76/228 - (33%)
Similarity:121/228 - (53%) Gaps:5/228 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GYDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIE 71
            ||..|.:.|||.|::.||:||..||......:||:..:.||||.||...|.||:..:..::..|.
Zfish     5 GYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKASNGVVLATEKKQKSILYDEQSVHKVEPIT 69

  Fly    72 KNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSI 136
            |:|||..:|:..|...:...||:.|..|...:::.||...|..|||..:..||....|||||:|:
Zfish    70 KHIGMVYSGMGPDYRVLVRRARKLAQQYFLVYQEPIPTGQLVQRVASVMQEYTQSGGVRPFGVSL 134

  Fly   137 ILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEK-LKMDMRTDELVESAGEIIYKV 200
            ::|.||| :.|.|::.:|||:.|.:.|.|.||.....||.:|| ...|:..::.:.:| .:..|.
Zfish   135 LIAGWDE-DRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTA-ILTLKE 197

  Fly   201 HDELKDKDFRFEMGLVGRVTGGLHLINPSELTE 233
            ..|.:..:...|:|:...  .|...:.|:|:.:
Zfish   198 SFEGQMTEDNIEVGICNE--AGFRRLTPAEVKD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 73/209 (35%)
PRE1 6..231 CDD:223711 75/224 (33%)
psma2aNP_001019612.1 PRK03996 5..233 CDD:235192 76/228 (33%)
proteasome_alpha_type_2 6..231 CDD:239719 75/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.