DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and psma4

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001007998.1 Gene:psma4 / 493360 XenbaseID:XB-GENE-5837209 Length:261 Species:Xenopus tropicalis


Alignment Length:251 Identity:72/251 - (28%)
Similarity:128/251 - (50%) Gaps:7/251 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLY-EPDAGGRIFTIE 71
            ||...:.|||:||::|::||.:|:..:||.:||...|.|:||.|:....||. |.....:|:.:.
 Frog     5 YDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLN 69

  Fly    72 KNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSI 136
            .::..:|||:.:|.|.:.:..|..|..|..|:::.||.:.|...:.....|||.:...||||:|:
 Frog    70 DDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSL 134

  Fly   137 ILASWDEVEGPQLYKIEPSGSSFGYFACASG--KAKQLAKTEMEKLKMDMRTDELVESAGEIIYK 199
            :...||:..|.|||:.:|||:..|:.|...|  .|..::..:.:..:.||.....:..|.:::.|
 Frog   135 LYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGDMTLKSALALAVKVLNK 199

  Fly   200 VHDELKDKDFRFEMGLVGRVTG--GLHLINPSELTE--KARKAGDAANKDEDSDNE 251
            ..|..|....:.|:..:.|..|  .:.::...|:.|  |..:..:|..:.|..:.|
 Frog   200 TMDVSKLSAEKVEIATLTRENGKTKIRVLKQKEVEELIKLHEEEEAKIEREKKEKE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 64/210 (30%)
PRE1 6..231 CDD:223711 66/227 (29%)
psma4NP_001007998.1 proteasome_alpha_type_4 3..216 CDD:239721 64/210 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.