DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and psmb1

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001003889.1 Gene:psmb1 / 445413 ZFINID:ZDB-GENE-040618-2 Length:237 Species:Danio rerio


Alignment Length:223 Identity:37/223 - (16%)
Similarity:83/223 - (37%) Gaps:33/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSASQFSPDGRVFQIDYASKAVEK-------SGTVIGIRGKDAVVLAVEKIITS--KLYEPDAGG 65
            :||..:..:|::.:..|......|       .|||:.:.|:|..::|.:..::.  .::..|: .
Zfish     2 ISAQAYGENGKMKEYHYTGPVEHKFSPYAFNGGTVLAVAGEDFAIVASDTRLSEGYSIHSRDS-P 65

  Fly    66 RIFTIEKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVR 130
            :.:.:.....:..:|...|...:..|.......|:....:::....:...::..::....:    
Zfish    66 KCYKLTDTTVLGCSGFHGDCLTLTKIIEARLKMYKHSNNKSMTSGAIAAMLSTILYGRRFF---- 126

  Fly   131 PFGLSIILASWDEVEGPQLYKIEPSGS--SFGYFACASGKA-------KQLAKTEMEKLK----- 181
            |:.:..|:...||.....:|..:|.||  ...|.|..|..|       .|:....||.::     
Zfish   127 PYYVYNIIGGLDEEGRGAVYSFDPVGSYQRDTYKAGGSASAMLQPLLDNQIGFKNMENVEHVPLT 191

  Fly   182 ----MDMRTDELVESAGEIIYKVHDELK 205
                :.:..|..:.:|...:| ..|.||
Zfish   192 QEKAVQLVKDVFISAAERDVY-TGDALK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 37/223 (17%)
PRE1 6..231 CDD:223711 37/223 (17%)
psmb1NP_001003889.1 PRE1 22..237 CDD:223711 33/203 (16%)
proteasome_beta_type_1 26..237 CDD:239726 32/199 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.