DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and psmb2

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001002609.1 Gene:psmb2 / 436882 ZFINID:ZDB-GENE-040718-353 Length:199 Species:Danio rerio


Alignment Length:202 Identity:47/202 - (23%)
Similarity:92/202 - (45%) Gaps:30/202 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIGIRGKDAVVLAVEKIITSKL----YEPDAGGRIFTIEKNIGMAVAGLVADGNFVADIARQEAA 97
            :|||:|.|.|::|.:.:..|.:    ::.|   ::|.:.:.|.:...|...|....|:..::...
Zfish     4 LIGIQGPDFVLVAADNVAASSIIQMKHDYD---KMFKLSEKILLLCVGEAGDTVQFAEYIQKNVQ 65

  Fly    98 NYRQ----QFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSIILASWDEVEGPQLYKIE-PSGS 157
            .|:.    :...|.........:|.|:.:.|      |:.::::||.:||.:||.||.:: .|..
Zfish    66 LYKMRNGYELSPAAAANFTRKNLADYLRSRT------PYHVNLLLAGYDETDGPGLYYMDYLSAL 124

  Fly   158 SFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEIIYKVHDELKDKDF-----RFEMGLVG 217
            :...|| |.|....|..:.:::.   .|.|...|.|.:::.|..:|| :|.|     .|.:.|:.
Zfish   125 AKAPFA-AHGYGAFLTLSILDRY---YRPDLTREEAVDLLKKCLEEL-NKRFILNLPSFTVRLID 184

  Fly   218 RVTGGLH 224
            :  .|:|
Zfish   185 K--DGIH 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 44/192 (23%)
PRE1 6..231 CDD:223711 47/202 (23%)
psmb2NP_001002609.1 proteasome_beta_type_2 1..192 CDD:239727 47/202 (23%)
PRE1 5..188 CDD:223711 45/198 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.