DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Prosalpha2

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster


Alignment Length:227 Identity:74/227 - (32%)
Similarity:116/227 - (51%) Gaps:5/227 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEK 72
            |..|.:.|||.|::.|::||..||......:||...:.||:|.|....|.|||..:..|:..|..
  Fly     6 YSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYN 70

  Fly    73 NIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSII 137
            :|||..:|:..|...:...||:.|..|...:::.||:..|..|||..:..||....|||||:|::
  Fly    71 HIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLL 135

  Fly   138 LASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEK-LKMDMRTDELVESAGEIIYKVH 201
            :..||. :.|.||:.:|||:.|.:.|.|.||.....||.:|| ...|:..|:.|.:| .:..|..
  Fly   136 ICGWDN-DRPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTA-ILTLKEG 198

  Fly   202 DELKDKDFRFEMGLVGRVTGGLHLINPSELTE 233
            .|.|......|:|:..:  .|...::|:.:.:
  Fly   199 FEGKMTADNIEIGICDQ--NGFQRLDPASIKD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 72/208 (35%)
PRE1 6..231 CDD:223711 74/223 (33%)
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 74/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440999
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.