DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Psma3l

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001004094.1 Gene:Psma3l / 408248 RGDID:1598236 Length:255 Species:Rattus norvegicus


Alignment Length:252 Identity:145/252 - (57%)
Similarity:186/252 - (73%) Gaps:1/252 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTIGTGYDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGG 65
            ||:||||||||||.|||||||||::||.||||.|.|.||||.||.||..|||::.|||||..:..
  Rat     1 MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNK 65

  Fly    66 RIFTIEKNIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVR 130
            |:|.:::::|||||||:||...:|||||:||:|:|..|...||||||..|||.||||||||||||
  Rat    66 RLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVR 130

  Fly   131 PFGLSIILASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKLKM-DMRTDELVESAG 194
            |||.|.:|.|:...:|.|||.|:|||.|:||:.||.|||:|.||||:|||:| :|...::|:...
  Rat   131 PFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVA 195

  Fly   195 EIIYKVHDELKDKDFRFEMGLVGRVTGGLHLINPSELTEKARKAGDAANKDEDSDNE 251
            :|||.||||:|||.|..|:..||.:|.|.|.|.|.::.|:|.|....:.|:||..::
  Rat   196 KIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDVREEAEKYAKESLKEEDESDD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 129/211 (61%)
PRE1 6..231 CDD:223711 135/225 (60%)
Psma3lNP_001004094.1 proteasome_alpha_type_3 5..217 CDD:239720 129/211 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 213 1.000 Domainoid score I2680
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 287 1.000 Inparanoid score I2759
OMA 1 1.010 - - QHG53517
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004628
OrthoInspector 1 1.000 - - oto97602
orthoMCL 1 0.900 - - OOG6_102011
Panther 1 1.100 - - LDO PTHR11599
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3238
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.