DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and psma8

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_998331.1 Gene:psma8 / 406445 ZFINID:ZDB-GENE-040426-2194 Length:251 Species:Danio rerio


Alignment Length:190 Identity:72/190 - (37%)
Similarity:112/190 - (58%) Gaps:4/190 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YDLSASQFSPDGRVFQIDYASKAVEKSGTVIGIRGKDAVVLAVEKIITSKLYEPDAGGRIFTIEK 72
            ||.:.:.|||||.:||::||.:||:|..|.:||||||.|||.|||...:||.|.....:|..:::
Zfish     5 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGKDIVVLGVEKKSVAKLQEERTVRKICALDE 69

  Fly    73 NIGMAVAGLVADGNFVADIARQEAANYRQQFEQAIPLKHLCHRVAGYVHAYTLYSAVRPFGLSII 137
            ::.||.|||.||...|.:.||.|..::|...|..:.::::...:|.....||..:..||||:|.:
Zfish    70 HVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIATLKQRYTQSNGRRPFGISAL 134

  Fly   138 LASWDEVEGPQLYKIEPSGSSFGYFACASGKAKQLAKTEMEKLKMDMRTDELVESAGEII 197
            :..:|....|:||:.:|||:...:.|.|.|::   |||..|.|:.:. |||.:.|..:.|
Zfish   135 IVGFDYDGTPRLYQTDPSGTYHAWKANAIGRS---AKTVREFLEKNY-TDEAIASDNDAI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 72/190 (38%)
PRE1 6..231 CDD:223711 72/190 (38%)
psma8NP_998331.1 proteasome_alpha_type_7 5..213 CDD:239724 72/190 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222564at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.