DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prosalpha7 and Prosbeta2

DIOPT Version :9

Sequence 1:NP_724834.1 Gene:Prosalpha7 / 36018 FlyBaseID:FBgn0023175 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_524076.2 Gene:Prosbeta2 / 39628 FlyBaseID:FBgn0023174 Length:272 Species:Drosophila melanogaster


Alignment Length:224 Identity:56/224 - (25%)
Similarity:86/224 - (38%) Gaps:56/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KSG-TVIGIRGKDAVVLAVEKIITSKLYEPDAG-GRIFTIEKNIGMAVAGLVADGNFVADIARQE 95
            |:| |::||..||.|:|..:...|......|.. .:|..:.|||....||..||.....|:...:
  Fly    37 KTGTTIVGIIYKDGVILGADTRATEGPIVSDKNCAKIHYLAKNIYCCGAGTAADTEMTTDLISSQ 101

  Fly    96 AANYRQQFEQAI-------PLKHLCHRVAGYVHAYTLYSAVRPFGLSIILASWDEVEGPQLYKIE 153
            ...:|.|.::.:       .||.:..|..|::.|            :::|...|:. ||.:|.|.
  Fly   102 LELHRLQTDREVRVVAANTMLKQMLFRYQGHISA------------ALVLGGVDKT-GPHIYSIH 153

  Fly   154 PSGSS--FGYFACASGKAKQLAKTEMEKLKMDMRTDE---LVESA-------------------- 193
            |.|||  ..|....||....:...| .:.|.|:..:|   ||..|                    
  Fly   154 PHGSSDKLPYATMGSGSLAAMTVFE-SRWKPDLSEEEGKKLVRDAIASGVFNDLGSGSNIDLCVI 217

  Fly   194 --GEIIYKVHDELKDK------DFRFEMG 214
              |.:.|..:.||.:|      |:||:.|
  Fly   218 RKGSVEYLRNYELANKKGKRQLDYRFKTG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prosalpha7NP_724834.1 proteasome_alpha_type_3 5..216 CDD:239720 56/224 (25%)
PRE1 6..231 CDD:223711 56/224 (25%)
Prosbeta2NP_524076.2 PRE1 42..232 CDD:223711 48/203 (24%)
proteasome_beta_type_7 42..228 CDD:239732 46/199 (23%)
Pr_beta_C 232..264 CDD:289249 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441015
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0638
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11599
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.